Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GCP5

Protein Details
Accession A0A2I1GCP5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
85-104IKWKRPFGKTYKKLKMNVQDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10, cyto_nucl 7.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSKQERDKLLLTLHNFKTELFLSYVDMKFEAVITSHKSLVCSQMLFKQFYKYPYLLPNLPNFNANLGQQLAPQLGKQRDQNHWIIKWKRPFGKTYKKLKMNVQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.36
4 0.35
5 0.3
6 0.27
7 0.19
8 0.18
9 0.16
10 0.22
11 0.22
12 0.19
13 0.18
14 0.16
15 0.14
16 0.14
17 0.11
18 0.06
19 0.08
20 0.11
21 0.13
22 0.15
23 0.15
24 0.17
25 0.17
26 0.2
27 0.19
28 0.16
29 0.15
30 0.19
31 0.22
32 0.23
33 0.23
34 0.23
35 0.24
36 0.25
37 0.28
38 0.23
39 0.22
40 0.23
41 0.26
42 0.25
43 0.25
44 0.27
45 0.27
46 0.27
47 0.25
48 0.22
49 0.2
50 0.19
51 0.17
52 0.14
53 0.12
54 0.11
55 0.11
56 0.12
57 0.11
58 0.1
59 0.11
60 0.16
61 0.17
62 0.21
63 0.26
64 0.31
65 0.36
66 0.41
67 0.48
68 0.47
69 0.5
70 0.56
71 0.56
72 0.59
73 0.62
74 0.66
75 0.67
76 0.64
77 0.67
78 0.68
79 0.73
80 0.74
81 0.76
82 0.78
83 0.78
84 0.79