Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1FVN6

Protein Details
Accession A0A2I1FVN6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-42PYVQKIRFENKIKKRKPQKICSDCKETSHydrophilic
NLS Segment(s)
PositionSequence
27-30KKRK
Subcellular Location(s) nucl 17, cyto_nucl 12.5, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MSSKNYGQKTCGTPPYVQKIRFENKIKKRKPQKICSDCKETSDSIKLFSSKVNKLEEIVDNFYKNPIKKNKNKQISIFNAKFTLNNIPCELEYDLSKFSLENLHKLVNFTTQNCNNNNKYSSSIEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.59
3 0.6
4 0.56
5 0.53
6 0.55
7 0.58
8 0.63
9 0.64
10 0.64
11 0.67
12 0.76
13 0.78
14 0.8
15 0.84
16 0.85
17 0.87
18 0.87
19 0.87
20 0.87
21 0.9
22 0.86
23 0.84
24 0.74
25 0.67
26 0.6
27 0.5
28 0.43
29 0.39
30 0.33
31 0.26
32 0.27
33 0.24
34 0.21
35 0.23
36 0.25
37 0.23
38 0.26
39 0.27
40 0.25
41 0.25
42 0.27
43 0.26
44 0.24
45 0.24
46 0.21
47 0.19
48 0.18
49 0.2
50 0.21
51 0.19
52 0.23
53 0.29
54 0.37
55 0.46
56 0.57
57 0.65
58 0.71
59 0.75
60 0.72
61 0.72
62 0.71
63 0.71
64 0.62
65 0.53
66 0.45
67 0.41
68 0.37
69 0.3
70 0.31
71 0.23
72 0.24
73 0.24
74 0.23
75 0.23
76 0.26
77 0.25
78 0.16
79 0.15
80 0.15
81 0.15
82 0.14
83 0.14
84 0.11
85 0.11
86 0.18
87 0.18
88 0.2
89 0.22
90 0.25
91 0.26
92 0.27
93 0.28
94 0.27
95 0.29
96 0.28
97 0.35
98 0.38
99 0.43
100 0.46
101 0.53
102 0.5
103 0.53
104 0.53
105 0.46
106 0.44