Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1H401

Protein Details
Accession A0A2I1H401   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
101-131SDDLDKTKENNKKKRKKKKAITRGKYRLVCIBasic
NLS Segment(s)
PositionSequence
109-125ENNKKKRKKKKAITRGK
Subcellular Location(s) nucl 19.5, mito_nucl 13, mito 5.5
Family & Domain DBs
Amino Acid Sequences MTNIFLMDRRKKFVSNRQIPCLHNSRKDDLDGTKSTKLYFDAMDQIEVVNQGTPSQITSSSHISNSKEIIEEFINLNEDFSKRLSLQPLVSTKPKNNNLSSDDLDKTKENNKKKRKKKKAITRGKYRLVCIFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.65
3 0.69
4 0.71
5 0.74
6 0.7
7 0.68
8 0.67
9 0.63
10 0.61
11 0.58
12 0.55
13 0.51
14 0.52
15 0.48
16 0.42
17 0.41
18 0.37
19 0.36
20 0.35
21 0.33
22 0.31
23 0.29
24 0.26
25 0.22
26 0.18
27 0.15
28 0.17
29 0.17
30 0.17
31 0.16
32 0.14
33 0.13
34 0.12
35 0.11
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.07
44 0.07
45 0.1
46 0.13
47 0.14
48 0.16
49 0.18
50 0.18
51 0.19
52 0.18
53 0.16
54 0.13
55 0.12
56 0.13
57 0.1
58 0.1
59 0.1
60 0.09
61 0.11
62 0.1
63 0.1
64 0.09
65 0.09
66 0.09
67 0.09
68 0.11
69 0.09
70 0.12
71 0.15
72 0.16
73 0.17
74 0.21
75 0.24
76 0.26
77 0.3
78 0.32
79 0.34
80 0.42
81 0.48
82 0.49
83 0.49
84 0.5
85 0.49
86 0.52
87 0.49
88 0.44
89 0.38
90 0.33
91 0.33
92 0.29
93 0.28
94 0.3
95 0.36
96 0.42
97 0.51
98 0.61
99 0.69
100 0.79
101 0.88
102 0.91
103 0.94
104 0.95
105 0.96
106 0.96
107 0.96
108 0.96
109 0.96
110 0.94
111 0.93
112 0.86
113 0.79