Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1G8V2

Protein Details
Accession A0A2I1G8V2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-45KVKSQTPKVEKQEKKKKKAGRAKKRILYNRRFVBasic
NLS Segment(s)
PositionSequence
11-38AGKVKSQTPKVEKQEKKKKKAGRAKKRI
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKKKAGRAKKRILYNRRFVNVTNMIGGKRRMNPAPTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.62
7 0.65
8 0.71
9 0.72
10 0.75
11 0.79
12 0.8
13 0.82
14 0.81
15 0.8
16 0.79
17 0.83
18 0.83
19 0.83
20 0.84
21 0.85
22 0.83
23 0.85
24 0.84
25 0.84
26 0.81
27 0.78
28 0.75
29 0.68
30 0.63
31 0.55
32 0.53
33 0.48
34 0.41
35 0.35
36 0.29
37 0.27
38 0.29
39 0.31
40 0.28
41 0.28
42 0.33
43 0.35
44 0.39