Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N3MYK4

Protein Details
Accession A0A2N3MYK4    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-28DASSEEPKKRGRGRPPKNGVAAVHydrophilic
NLS Segment(s)
PositionSequence
12-73PKKRGRGRPPKNGVAAVKKAYVPTGRPRGRPKGSGTPKKAAYVPTGKPRGRPPGSGKKKSAR
102-121RAARAGARGGTRGRPKGTTK
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MAPTTDASSEEPKKRGRGRPPKNGVAAVKKAYVPTGRPRGRPKGSGTPKKAAYVPTGKPRGRPPGSGKKKSARATAAEEAALEEVEQQAAVKAKKTADNTSRAARAGARGGTRGRPKGTTKKTPVAEEEEEEEEAEEEAEEEDDDEVRAENEGSDEDSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.68
4 0.71
5 0.75
6 0.81
7 0.85
8 0.84
9 0.8
10 0.77
11 0.72
12 0.69
13 0.64
14 0.55
15 0.49
16 0.41
17 0.37
18 0.34
19 0.31
20 0.27
21 0.31
22 0.39
23 0.43
24 0.49
25 0.56
26 0.62
27 0.65
28 0.66
29 0.63
30 0.64
31 0.69
32 0.72
33 0.7
34 0.67
35 0.64
36 0.61
37 0.56
38 0.47
39 0.42
40 0.39
41 0.38
42 0.4
43 0.47
44 0.45
45 0.47
46 0.5
47 0.55
48 0.5
49 0.51
50 0.51
51 0.53
52 0.63
53 0.66
54 0.66
55 0.63
56 0.68
57 0.66
58 0.63
59 0.55
60 0.48
61 0.47
62 0.44
63 0.37
64 0.28
65 0.24
66 0.19
67 0.16
68 0.13
69 0.06
70 0.04
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.07
77 0.07
78 0.08
79 0.1
80 0.12
81 0.17
82 0.21
83 0.27
84 0.29
85 0.34
86 0.36
87 0.38
88 0.38
89 0.34
90 0.32
91 0.25
92 0.22
93 0.2
94 0.19
95 0.16
96 0.18
97 0.19
98 0.25
99 0.31
100 0.34
101 0.33
102 0.35
103 0.41
104 0.49
105 0.56
106 0.6
107 0.61
108 0.65
109 0.66
110 0.65
111 0.62
112 0.58
113 0.52
114 0.44
115 0.4
116 0.33
117 0.3
118 0.26
119 0.23
120 0.16
121 0.13
122 0.11
123 0.07
124 0.06
125 0.06
126 0.06
127 0.05
128 0.06
129 0.06
130 0.06
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.08
139 0.09