Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N3NB96

Protein Details
Accession A0A2N3NB96    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-80HFATLKPEQKKKKEAKPGDKKSGGGBasic
NLS Segment(s)
PositionSequence
63-86EQKKKKEAKPGDKKSGGGVKGFFP
Subcellular Location(s) cyto 11.5, cyto_nucl 7, E.R. 5, mito 4, plas 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSEPITGGGDQFAWFRSLGATEEAVMVLNDQPILFTILLVVLVTLILQGVLLWYIHFATLKPEQKKKKEAKPGDKKSGGGVKGFFPAALRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.1
5 0.1
6 0.11
7 0.11
8 0.1
9 0.1
10 0.1
11 0.1
12 0.08
13 0.07
14 0.06
15 0.06
16 0.06
17 0.05
18 0.05
19 0.05
20 0.08
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.05
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.08
46 0.17
47 0.24
48 0.31
49 0.39
50 0.48
51 0.55
52 0.65
53 0.7
54 0.72
55 0.76
56 0.8
57 0.83
58 0.85
59 0.88
60 0.89
61 0.83
62 0.74
63 0.7
64 0.67
65 0.57
66 0.49
67 0.41
68 0.33
69 0.32
70 0.32
71 0.25