Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P8P8

Protein Details
Accession J3P8P8    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-51SLRVCKRDKIHEKINPFKKGBasic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MGVKLYTLKTGFFKRIAVFLKNYLNFHYGNESLRVCKRDKIHEKINPFKKGCNFFRSGFACGILCFKRFFMLGFKITFARAFIAKKSKFRVSLASTFGINNKICFGKKNFVKGNFKSGLKVAGLIIVASKRDKHGIRLFRLICFKKKGFKVQATFGINNKICFGKKNFVKGNFKSGLKVAGLIIVASKRDKHGIRLFRLICFKKKGFKVQGPVKAFALYIHVTPCPPCLLSFPLNAWKRHTLPGRGTALPMPQASDIYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.41
4 0.4
5 0.38
6 0.38
7 0.46
8 0.45
9 0.45
10 0.41
11 0.39
12 0.35
13 0.33
14 0.33
15 0.26
16 0.25
17 0.27
18 0.25
19 0.28
20 0.33
21 0.35
22 0.32
23 0.36
24 0.39
25 0.46
26 0.54
27 0.57
28 0.62
29 0.66
30 0.73
31 0.77
32 0.81
33 0.79
34 0.71
35 0.69
36 0.67
37 0.69
38 0.66
39 0.62
40 0.58
41 0.5
42 0.57
43 0.53
44 0.48
45 0.39
46 0.35
47 0.27
48 0.23
49 0.27
50 0.2
51 0.18
52 0.16
53 0.16
54 0.16
55 0.16
56 0.16
57 0.17
58 0.2
59 0.22
60 0.22
61 0.23
62 0.22
63 0.23
64 0.22
65 0.16
66 0.13
67 0.13
68 0.14
69 0.17
70 0.26
71 0.29
72 0.33
73 0.38
74 0.42
75 0.42
76 0.42
77 0.45
78 0.41
79 0.43
80 0.41
81 0.37
82 0.32
83 0.3
84 0.3
85 0.27
86 0.22
87 0.17
88 0.15
89 0.16
90 0.16
91 0.19
92 0.22
93 0.25
94 0.28
95 0.37
96 0.4
97 0.46
98 0.54
99 0.52
100 0.56
101 0.52
102 0.49
103 0.41
104 0.36
105 0.3
106 0.22
107 0.21
108 0.13
109 0.1
110 0.09
111 0.08
112 0.08
113 0.06
114 0.07
115 0.07
116 0.07
117 0.07
118 0.12
119 0.13
120 0.19
121 0.26
122 0.32
123 0.35
124 0.42
125 0.42
126 0.41
127 0.48
128 0.45
129 0.42
130 0.41
131 0.4
132 0.39
133 0.43
134 0.48
135 0.48
136 0.52
137 0.51
138 0.49
139 0.55
140 0.52
141 0.5
142 0.42
143 0.43
144 0.37
145 0.34
146 0.31
147 0.25
148 0.21
149 0.23
150 0.25
151 0.25
152 0.28
153 0.36
154 0.4
155 0.46
156 0.54
157 0.52
158 0.56
159 0.52
160 0.49
161 0.41
162 0.36
163 0.3
164 0.22
165 0.21
166 0.13
167 0.1
168 0.09
169 0.08
170 0.08
171 0.06
172 0.07
173 0.07
174 0.07
175 0.07
176 0.12
177 0.13
178 0.19
179 0.26
180 0.32
181 0.35
182 0.42
183 0.42
184 0.41
185 0.48
186 0.45
187 0.42
188 0.41
189 0.4
190 0.39
191 0.43
192 0.5
193 0.51
194 0.55
195 0.61
196 0.64
197 0.72
198 0.69
199 0.68
200 0.58
201 0.5
202 0.43
203 0.33
204 0.28
205 0.2
206 0.16
207 0.15
208 0.15
209 0.15
210 0.16
211 0.17
212 0.15
213 0.15
214 0.14
215 0.16
216 0.21
217 0.23
218 0.25
219 0.28
220 0.35
221 0.4
222 0.41
223 0.43
224 0.44
225 0.44
226 0.51
227 0.54
228 0.52
229 0.53
230 0.59
231 0.59
232 0.53
233 0.53
234 0.47
235 0.43
236 0.4
237 0.34
238 0.28
239 0.23