Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N3NI45

Protein Details
Accession A0A2N3NI45   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
255-282IEKPPDMRSIRRKEREERKRFKAAQAAQHydrophilic
NLS Segment(s)
PositionSequence
262-276RSIRRKEREERKRFK
Subcellular Location(s) mito 18, cyto 5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007715  Coq4  
IPR027540  Coq4_euk  
Gene Ontology GO:0031314  C:extrinsic component of mitochondrial inner membrane  
GO:0006744  P:ubiquinone biosynthetic process  
Pfam View protein in Pfam  
PF05019  Coq4  
Amino Acid Sequences MNLVRASVRASQALQPVKAVTYAQHAQAFSVLNRPPPNYPGHVPLTRIERAALAVGSGLTSFFDPYRGDMISAFGETTATPYFIYRLRDAMLADPTGRRILRDRPRMTSTSLDLDRLRSLPENTVGRSYVGWLDREGVSPDTRPHVRFIDDAECAYVMQRYRECHDFYHALTGLPIVREGEVALKAFEFANLLIPMTGLSIFSVLTLKPGERRRFFETYLPWALRNGMKAKDVINIYWEEQMERDVDDLRAELGIEKPPDMRSIRRKEREERKRFKAAQAAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.3
4 0.28
5 0.27
6 0.23
7 0.17
8 0.19
9 0.21
10 0.24
11 0.27
12 0.26
13 0.25
14 0.27
15 0.28
16 0.21
17 0.25
18 0.23
19 0.25
20 0.29
21 0.31
22 0.31
23 0.32
24 0.37
25 0.35
26 0.37
27 0.37
28 0.4
29 0.4
30 0.39
31 0.4
32 0.41
33 0.38
34 0.35
35 0.29
36 0.23
37 0.21
38 0.21
39 0.16
40 0.1
41 0.08
42 0.08
43 0.07
44 0.06
45 0.05
46 0.05
47 0.05
48 0.06
49 0.06
50 0.08
51 0.08
52 0.1
53 0.13
54 0.13
55 0.13
56 0.12
57 0.14
58 0.13
59 0.12
60 0.11
61 0.08
62 0.08
63 0.07
64 0.1
65 0.08
66 0.08
67 0.08
68 0.08
69 0.1
70 0.13
71 0.17
72 0.15
73 0.16
74 0.17
75 0.18
76 0.18
77 0.19
78 0.18
79 0.15
80 0.15
81 0.14
82 0.14
83 0.16
84 0.16
85 0.14
86 0.16
87 0.25
88 0.34
89 0.44
90 0.46
91 0.48
92 0.53
93 0.53
94 0.53
95 0.46
96 0.38
97 0.35
98 0.32
99 0.29
100 0.25
101 0.24
102 0.22
103 0.2
104 0.19
105 0.14
106 0.15
107 0.14
108 0.18
109 0.19
110 0.18
111 0.19
112 0.18
113 0.17
114 0.16
115 0.15
116 0.13
117 0.12
118 0.12
119 0.11
120 0.12
121 0.12
122 0.13
123 0.14
124 0.12
125 0.11
126 0.12
127 0.12
128 0.15
129 0.16
130 0.17
131 0.18
132 0.18
133 0.19
134 0.18
135 0.2
136 0.2
137 0.18
138 0.17
139 0.15
140 0.13
141 0.12
142 0.11
143 0.1
144 0.07
145 0.09
146 0.12
147 0.13
148 0.16
149 0.2
150 0.22
151 0.21
152 0.25
153 0.25
154 0.23
155 0.27
156 0.24
157 0.2
158 0.18
159 0.18
160 0.14
161 0.12
162 0.12
163 0.06
164 0.06
165 0.06
166 0.06
167 0.08
168 0.08
169 0.08
170 0.08
171 0.07
172 0.08
173 0.08
174 0.07
175 0.06
176 0.05
177 0.08
178 0.08
179 0.09
180 0.08
181 0.08
182 0.08
183 0.08
184 0.07
185 0.04
186 0.04
187 0.04
188 0.04
189 0.05
190 0.06
191 0.05
192 0.07
193 0.08
194 0.09
195 0.16
196 0.25
197 0.33
198 0.37
199 0.43
200 0.48
201 0.52
202 0.53
203 0.53
204 0.49
205 0.47
206 0.5
207 0.46
208 0.39
209 0.35
210 0.36
211 0.31
212 0.31
213 0.28
214 0.24
215 0.24
216 0.25
217 0.26
218 0.28
219 0.28
220 0.23
221 0.22
222 0.22
223 0.21
224 0.24
225 0.23
226 0.18
227 0.16
228 0.17
229 0.15
230 0.13
231 0.13
232 0.11
233 0.11
234 0.11
235 0.11
236 0.1
237 0.1
238 0.09
239 0.1
240 0.1
241 0.15
242 0.15
243 0.16
244 0.18
245 0.19
246 0.25
247 0.27
248 0.34
249 0.39
250 0.49
251 0.59
252 0.67
253 0.73
254 0.78
255 0.85
256 0.88
257 0.89
258 0.88
259 0.85
260 0.86
261 0.83
262 0.81
263 0.8