Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N3NHF4

Protein Details
Accession A0A2N3NHF4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-28AAAAGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
7-22AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAAAAGAKKQKKKWSKGKVKDKAQHAVILDKATSEKLYKDVQSYRLVTVATLVDRMKINGSLARQCLRDLEEKGLIKPVVEHSKMKIYTRAVGASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.88
4 0.92
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.48
14 0.39
15 0.33
16 0.25
17 0.18
18 0.17
19 0.13
20 0.13
21 0.11
22 0.1
23 0.11
24 0.14
25 0.15
26 0.19
27 0.21
28 0.23
29 0.27
30 0.28
31 0.25
32 0.24
33 0.22
34 0.18
35 0.16
36 0.13
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.09
44 0.09
45 0.1
46 0.11
47 0.13
48 0.15
49 0.18
50 0.21
51 0.2
52 0.2
53 0.21
54 0.21
55 0.25
56 0.23
57 0.25
58 0.29
59 0.29
60 0.29
61 0.33
62 0.3
63 0.24
64 0.24
65 0.27
66 0.29
67 0.31
68 0.32
69 0.31
70 0.4
71 0.43
72 0.44
73 0.43
74 0.38
75 0.4
76 0.42