Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N3NHX6

Protein Details
Accession A0A2N3NHX6   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
253-273DLRRAEEQRLKKRKERMAKDGBasic
NLS Segment(s)
PositionSequence
156-159KKKA
262-267LKKRKE
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013260  mRNA_splic_SYF2  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF08231  SYF2  
Amino Acid Sequences MPPAKKRKTQAGEEPDPEAASSNPEQASADEPSEEPTPQEPSEPTEPKPSSSSTPSSSTPAGPSAPALSAKDRLARFKALKARAKTSSEENFKAATREAQRVTEDPSQLASLQRKHAIASHKLVKADIEEAGGDFERKRAWDWTVDESESWDRRMKKKAARRDGNLFADYTSEANKVYKRQLRNIAPDMERYEKDKMKAIERAAASGGLDLIETEDGELIAVDKDGSFYSTEDSTTFTENKPDKAAIDRLVDDLRRAEEQRLKKRKERMAKDGDDGDVTYINEKNKQFNQKLARFYNKYTADLRDSFERGTMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.58
3 0.51
4 0.42
5 0.32
6 0.22
7 0.19
8 0.18
9 0.19
10 0.18
11 0.19
12 0.19
13 0.19
14 0.22
15 0.2
16 0.19
17 0.16
18 0.16
19 0.19
20 0.2
21 0.19
22 0.17
23 0.16
24 0.2
25 0.2
26 0.22
27 0.2
28 0.24
29 0.33
30 0.35
31 0.35
32 0.4
33 0.41
34 0.4
35 0.42
36 0.39
37 0.35
38 0.38
39 0.4
40 0.34
41 0.37
42 0.36
43 0.37
44 0.36
45 0.32
46 0.28
47 0.26
48 0.22
49 0.18
50 0.17
51 0.15
52 0.15
53 0.15
54 0.15
55 0.16
56 0.18
57 0.2
58 0.25
59 0.26
60 0.29
61 0.31
62 0.36
63 0.36
64 0.4
65 0.47
66 0.5
67 0.56
68 0.55
69 0.58
70 0.57
71 0.58
72 0.53
73 0.52
74 0.51
75 0.5
76 0.47
77 0.43
78 0.38
79 0.36
80 0.35
81 0.28
82 0.26
83 0.23
84 0.26
85 0.26
86 0.27
87 0.28
88 0.28
89 0.33
90 0.31
91 0.28
92 0.23
93 0.22
94 0.21
95 0.19
96 0.22
97 0.21
98 0.19
99 0.22
100 0.24
101 0.24
102 0.23
103 0.27
104 0.29
105 0.29
106 0.32
107 0.36
108 0.35
109 0.35
110 0.35
111 0.31
112 0.26
113 0.23
114 0.17
115 0.1
116 0.07
117 0.07
118 0.08
119 0.08
120 0.07
121 0.06
122 0.06
123 0.07
124 0.07
125 0.09
126 0.1
127 0.12
128 0.16
129 0.19
130 0.23
131 0.25
132 0.24
133 0.23
134 0.23
135 0.26
136 0.22
137 0.21
138 0.2
139 0.22
140 0.26
141 0.34
142 0.38
143 0.42
144 0.49
145 0.58
146 0.64
147 0.68
148 0.68
149 0.68
150 0.68
151 0.63
152 0.55
153 0.45
154 0.34
155 0.27
156 0.23
157 0.16
158 0.11
159 0.08
160 0.08
161 0.09
162 0.11
163 0.13
164 0.2
165 0.26
166 0.28
167 0.35
168 0.44
169 0.48
170 0.53
171 0.55
172 0.53
173 0.48
174 0.47
175 0.44
176 0.39
177 0.34
178 0.3
179 0.31
180 0.28
181 0.29
182 0.32
183 0.31
184 0.31
185 0.36
186 0.34
187 0.34
188 0.31
189 0.31
190 0.25
191 0.23
192 0.18
193 0.13
194 0.12
195 0.06
196 0.05
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.05
212 0.05
213 0.06
214 0.06
215 0.07
216 0.09
217 0.09
218 0.1
219 0.1
220 0.12
221 0.13
222 0.15
223 0.16
224 0.15
225 0.23
226 0.24
227 0.26
228 0.27
229 0.26
230 0.24
231 0.28
232 0.32
233 0.27
234 0.29
235 0.28
236 0.27
237 0.3
238 0.29
239 0.25
240 0.22
241 0.21
242 0.21
243 0.22
244 0.26
245 0.31
246 0.4
247 0.5
248 0.59
249 0.63
250 0.67
251 0.75
252 0.79
253 0.81
254 0.8
255 0.8
256 0.8
257 0.77
258 0.75
259 0.68
260 0.6
261 0.5
262 0.41
263 0.32
264 0.23
265 0.19
266 0.17
267 0.17
268 0.18
269 0.23
270 0.25
271 0.31
272 0.38
273 0.48
274 0.49
275 0.55
276 0.63
277 0.63
278 0.7
279 0.71
280 0.74
281 0.67
282 0.69
283 0.69
284 0.62
285 0.59
286 0.54
287 0.51
288 0.47
289 0.45
290 0.45
291 0.41
292 0.4
293 0.37