Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NL81

Protein Details
Accession J3NL81    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
61-80ATLLWFKRRRFPREIPRVAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 7, nucl 5
Family & Domain DBs
Amino Acid Sequences MPQRFTRPNRPDEPPGYDRARAPPPDSGSSSAVAELGLLALRVCPPPRWCTGGGNPWLLSATLLWFKRRRFPREIPRVAPHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.59
3 0.55
4 0.51
5 0.45
6 0.43
7 0.45
8 0.39
9 0.38
10 0.37
11 0.37
12 0.39
13 0.39
14 0.36
15 0.31
16 0.29
17 0.27
18 0.21
19 0.16
20 0.12
21 0.09
22 0.06
23 0.04
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.05
30 0.06
31 0.09
32 0.11
33 0.15
34 0.18
35 0.22
36 0.23
37 0.26
38 0.31
39 0.36
40 0.37
41 0.36
42 0.33
43 0.3
44 0.29
45 0.24
46 0.18
47 0.11
48 0.1
49 0.14
50 0.15
51 0.21
52 0.26
53 0.28
54 0.38
55 0.47
56 0.51
57 0.54
58 0.63
59 0.69
60 0.75
61 0.81
62 0.79