Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N3NLR5

Protein Details
Accession A0A2N3NLR5   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
56-80RDSIRFTARRRRKKGDVRRKSTGSABasic
NLS Segment(s)
PositionSequence
63-86ARRRRKKGDVRRKSTGSAKSSKSE
Subcellular Location(s) mito 6plas 6extr 6, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYIPIASEPGAHLPRLIKRQFTGNAGHDTNITIGIIVAIVLTVFIIGVGAFMYTYRDSIRFTARRRRKKGDVRRKSTGSAKSSKSEKSAASDGGGDPPPPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.36
3 0.38
4 0.34
5 0.34
6 0.41
7 0.43
8 0.42
9 0.41
10 0.37
11 0.4
12 0.37
13 0.36
14 0.28
15 0.26
16 0.23
17 0.17
18 0.12
19 0.06
20 0.05
21 0.05
22 0.04
23 0.03
24 0.03
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.01
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.04
40 0.04
41 0.05
42 0.06
43 0.07
44 0.08
45 0.1
46 0.19
47 0.23
48 0.28
49 0.39
50 0.48
51 0.58
52 0.65
53 0.72
54 0.74
55 0.79
56 0.86
57 0.86
58 0.87
59 0.85
60 0.85
61 0.81
62 0.75
63 0.72
64 0.69
65 0.64
66 0.61
67 0.56
68 0.54
69 0.55
70 0.53
71 0.49
72 0.45
73 0.4
74 0.39
75 0.39
76 0.34
77 0.3
78 0.29
79 0.26
80 0.27
81 0.27