Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N3N2W9

Protein Details
Accession A0A2N3N2W9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
244-270TNGRALARKASKSRKEKKSIAPVGRTAHydrophilic
NLS Segment(s)
PositionSequence
245-272NGRALARKASKSRKEKKSIAPVGRTARR
Subcellular Location(s) cyto_nucl 11.333, cyto 11, nucl 9.5, mito_nucl 8.166, mito 5.5
Family & Domain DBs
Amino Acid Sequences MAEEQVNTAPAIPVSEEATKVAEPPTEAKATEQQETVVPVSTSGPVSEAKKDAALNDADTNTTTAAAKAQDASAPALAADSAAPTEPTKAGAAATMNGGAKEVVAEACAPEKTEVGEQAESSKDAEQPSVPAPATTEVPKPTEETVAEEKSVEEKPTEEKVVEEKAPEEKPAETKPVEEQPTVSNGEAADVEIKDAPEAPVVPEASESQAGGKRSADEAEFTNGGEASEPVGKKAKVAEEAPATNGRALARKASKSRKEKKSIAPVGRTARRTRSQGLADV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.14
5 0.17
6 0.16
7 0.16
8 0.17
9 0.15
10 0.15
11 0.17
12 0.21
13 0.21
14 0.21
15 0.23
16 0.29
17 0.31
18 0.32
19 0.29
20 0.25
21 0.25
22 0.27
23 0.25
24 0.2
25 0.16
26 0.14
27 0.15
28 0.16
29 0.14
30 0.11
31 0.12
32 0.13
33 0.16
34 0.18
35 0.19
36 0.18
37 0.2
38 0.21
39 0.2
40 0.21
41 0.2
42 0.18
43 0.19
44 0.19
45 0.17
46 0.17
47 0.17
48 0.13
49 0.12
50 0.1
51 0.08
52 0.09
53 0.09
54 0.09
55 0.09
56 0.1
57 0.1
58 0.11
59 0.12
60 0.1
61 0.1
62 0.09
63 0.08
64 0.07
65 0.06
66 0.05
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.07
73 0.07
74 0.09
75 0.09
76 0.09
77 0.08
78 0.09
79 0.09
80 0.08
81 0.09
82 0.09
83 0.09
84 0.08
85 0.09
86 0.07
87 0.06
88 0.06
89 0.06
90 0.04
91 0.04
92 0.04
93 0.04
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.08
100 0.09
101 0.1
102 0.11
103 0.12
104 0.11
105 0.12
106 0.12
107 0.11
108 0.12
109 0.11
110 0.11
111 0.11
112 0.11
113 0.1
114 0.11
115 0.12
116 0.13
117 0.12
118 0.1
119 0.1
120 0.11
121 0.12
122 0.12
123 0.13
124 0.12
125 0.13
126 0.14
127 0.15
128 0.14
129 0.15
130 0.13
131 0.15
132 0.18
133 0.18
134 0.17
135 0.16
136 0.15
137 0.16
138 0.17
139 0.13
140 0.09
141 0.09
142 0.12
143 0.15
144 0.16
145 0.13
146 0.13
147 0.15
148 0.18
149 0.18
150 0.15
151 0.14
152 0.17
153 0.18
154 0.18
155 0.17
156 0.15
157 0.18
158 0.19
159 0.23
160 0.18
161 0.19
162 0.22
163 0.28
164 0.29
165 0.26
166 0.25
167 0.22
168 0.25
169 0.26
170 0.22
171 0.15
172 0.12
173 0.13
174 0.12
175 0.1
176 0.09
177 0.07
178 0.08
179 0.08
180 0.08
181 0.07
182 0.08
183 0.08
184 0.07
185 0.08
186 0.08
187 0.11
188 0.11
189 0.11
190 0.11
191 0.12
192 0.12
193 0.13
194 0.11
195 0.11
196 0.15
197 0.16
198 0.16
199 0.16
200 0.15
201 0.16
202 0.18
203 0.15
204 0.13
205 0.14
206 0.17
207 0.17
208 0.15
209 0.15
210 0.13
211 0.13
212 0.12
213 0.1
214 0.08
215 0.13
216 0.13
217 0.14
218 0.2
219 0.2
220 0.2
221 0.24
222 0.27
223 0.27
224 0.28
225 0.32
226 0.32
227 0.33
228 0.35
229 0.34
230 0.31
231 0.26
232 0.27
233 0.23
234 0.22
235 0.22
236 0.28
237 0.31
238 0.38
239 0.47
240 0.56
241 0.64
242 0.7
243 0.8
244 0.82
245 0.84
246 0.86
247 0.87
248 0.88
249 0.88
250 0.86
251 0.82
252 0.79
253 0.8
254 0.79
255 0.74
256 0.69
257 0.68
258 0.66
259 0.66
260 0.63
261 0.62