Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N3N709

Protein Details
Accession A0A2N3N709    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGNGAKAQQKRERNQKDQKVAKSQLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 10, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039713  At2g23090-like  
IPR039438  At2g23090-like_Znf  
IPR007513  SERF-like_N  
IPR026939  ZNF706/At2g23090_sf  
Pfam View protein in Pfam  
PF04419  4F5  
PF12907  zf-met2  
Amino Acid Sequences MGNGAKAQQKRERNQKDQKVAKSQLKSNAAACNIVCNVCKQTFLQTSKAPALTAHAENKHGKTITDCFPEFQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.87
4 0.86
5 0.84
6 0.82
7 0.8
8 0.77
9 0.71
10 0.66
11 0.64
12 0.6
13 0.54
14 0.47
15 0.43
16 0.36
17 0.32
18 0.27
19 0.21
20 0.17
21 0.17
22 0.14
23 0.11
24 0.13
25 0.12
26 0.14
27 0.11
28 0.17
29 0.24
30 0.26
31 0.29
32 0.28
33 0.32
34 0.33
35 0.33
36 0.27
37 0.2
38 0.21
39 0.2
40 0.22
41 0.24
42 0.23
43 0.28
44 0.32
45 0.33
46 0.35
47 0.32
48 0.29
49 0.28
50 0.32
51 0.35
52 0.38
53 0.37