Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AJ44

Protein Details
Accession G3AJ44    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MFDRNKRDKHRGRELERVSMBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 7.333, pero 3, E.R. 3, mito 2.5, cyto_mito 2.333, extr 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR030125  SPIN90/Ldb17  
IPR018556  SPIN90/Ldb17_LRD  
KEGG spaa:SPAPADRAFT_59978  -  
Pfam View protein in Pfam  
PF09431  SPIN90_LRD  
Amino Acid Sequences MFDRNKRDKHRGRELERVSMHYFLNCPTEQLELLPADMLYSALSEFNFVAVASHFISAQIKAANGNLQSTDTSYVILKFSCDIFFEYLFHIELFNDGEFTCLTNTDLIPTVITYLLDNENFNNYDLDSDDFENEDKLIAYEEFKLLLLINEQYMMRSYTSNVNNRVFDGLMRGKSEQPNLTNITGFINLLIYHLNREESNIIKILILKFLYLVFTTSYVTKMVYLNDLKILIDIFIRELNNMDNSKENR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.72
4 0.68
5 0.59
6 0.51
7 0.45
8 0.36
9 0.32
10 0.24
11 0.27
12 0.22
13 0.2
14 0.18
15 0.2
16 0.18
17 0.18
18 0.19
19 0.14
20 0.14
21 0.13
22 0.11
23 0.09
24 0.09
25 0.08
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.07
37 0.06
38 0.08
39 0.08
40 0.08
41 0.08
42 0.09
43 0.1
44 0.1
45 0.11
46 0.1
47 0.09
48 0.1
49 0.11
50 0.13
51 0.12
52 0.13
53 0.12
54 0.12
55 0.12
56 0.13
57 0.14
58 0.11
59 0.11
60 0.11
61 0.11
62 0.11
63 0.11
64 0.1
65 0.08
66 0.09
67 0.09
68 0.1
69 0.11
70 0.12
71 0.12
72 0.12
73 0.13
74 0.13
75 0.13
76 0.11
77 0.1
78 0.08
79 0.08
80 0.09
81 0.07
82 0.07
83 0.06
84 0.07
85 0.07
86 0.07
87 0.07
88 0.06
89 0.06
90 0.07
91 0.07
92 0.07
93 0.08
94 0.07
95 0.07
96 0.07
97 0.07
98 0.06
99 0.07
100 0.05
101 0.06
102 0.07
103 0.08
104 0.08
105 0.08
106 0.09
107 0.1
108 0.1
109 0.09
110 0.08
111 0.08
112 0.08
113 0.09
114 0.08
115 0.08
116 0.08
117 0.08
118 0.08
119 0.08
120 0.07
121 0.06
122 0.05
123 0.04
124 0.05
125 0.05
126 0.06
127 0.07
128 0.07
129 0.07
130 0.07
131 0.07
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.07
138 0.06
139 0.06
140 0.07
141 0.08
142 0.08
143 0.08
144 0.09
145 0.16
146 0.22
147 0.27
148 0.32
149 0.34
150 0.34
151 0.34
152 0.34
153 0.27
154 0.21
155 0.21
156 0.2
157 0.18
158 0.2
159 0.21
160 0.24
161 0.27
162 0.31
163 0.29
164 0.27
165 0.29
166 0.31
167 0.3
168 0.27
169 0.24
170 0.22
171 0.18
172 0.16
173 0.12
174 0.09
175 0.08
176 0.08
177 0.1
178 0.08
179 0.09
180 0.1
181 0.12
182 0.11
183 0.13
184 0.16
185 0.16
186 0.18
187 0.18
188 0.17
189 0.16
190 0.2
191 0.18
192 0.19
193 0.17
194 0.14
195 0.14
196 0.14
197 0.15
198 0.12
199 0.12
200 0.09
201 0.1
202 0.11
203 0.12
204 0.12
205 0.11
206 0.12
207 0.12
208 0.13
209 0.13
210 0.19
211 0.2
212 0.2
213 0.22
214 0.22
215 0.2
216 0.19
217 0.18
218 0.12
219 0.11
220 0.1
221 0.1
222 0.13
223 0.13
224 0.13
225 0.14
226 0.16
227 0.22
228 0.22
229 0.23