Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N3NLH0

Protein Details
Accession A0A2N3NLH0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VSAKKHVPIVKKRTKKFARHQSDRFKCVDPSWRKPKGIDSRVRRRFRGBasic
NLS Segment(s)
PositionSequence
9-20PIVKKRTKKFAR
34-46RKPKGIDSRVRRR
Subcellular Location(s) mito 16.5, mito_nucl 13.333, nucl 9, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKKFARHQSDRFKCVDPSWRKPKGIDSRVRRRFRGNQVMPSIGFGSNKKTKYMMPSGHRAFLVSNVNDVELLLMHNRTHAAEIAHNVSSRKRIDIIARAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.84
4 0.85
5 0.85
6 0.86
7 0.86
8 0.9
9 0.9
10 0.89
11 0.83
12 0.76
13 0.67
14 0.59
15 0.52
16 0.53
17 0.5
18 0.52
19 0.57
20 0.61
21 0.59
22 0.58
23 0.64
24 0.65
25 0.65
26 0.65
27 0.65
28 0.69
29 0.77
30 0.81
31 0.74
32 0.7
33 0.7
34 0.71
35 0.72
36 0.66
37 0.63
38 0.6
39 0.6
40 0.52
41 0.44
42 0.35
43 0.25
44 0.21
45 0.14
46 0.17
47 0.21
48 0.22
49 0.22
50 0.21
51 0.22
52 0.26
53 0.32
54 0.33
55 0.31
56 0.38
57 0.39
58 0.4
59 0.38
60 0.33
61 0.27
62 0.24
63 0.25
64 0.17
65 0.16
66 0.15
67 0.15
68 0.14
69 0.14
70 0.1
71 0.05
72 0.06
73 0.05
74 0.06
75 0.06
76 0.07
77 0.08
78 0.08
79 0.09
80 0.1
81 0.1
82 0.11
83 0.14
84 0.16
85 0.17
86 0.18
87 0.18
88 0.19
89 0.23
90 0.23
91 0.22
92 0.21
93 0.23
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.33
105 0.3
106 0.35
107 0.43
108 0.5
109 0.49
110 0.5
111 0.47