Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PA68

Protein Details
Accession J3PA68    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-31SDEKDPWSDKHKQKFRSKSKSEWYDPHydrophilic
58-78QAYRDCKKNWISRRRHDVDKPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MASQPSDEKDPWSDKHKQKFRSKSKSEWYDPCQEAASKSIQCLNRNGGDRAMCQDYFQAYRDCKKNWISRRRHDVDKPDPTLAPEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.59
3 0.65
4 0.69
5 0.74
6 0.81
7 0.85
8 0.86
9 0.84
10 0.82
11 0.84
12 0.83
13 0.79
14 0.76
15 0.7
16 0.68
17 0.62
18 0.55
19 0.45
20 0.37
21 0.31
22 0.25
23 0.24
24 0.15
25 0.15
26 0.19
27 0.21
28 0.22
29 0.23
30 0.24
31 0.25
32 0.28
33 0.28
34 0.25
35 0.23
36 0.22
37 0.23
38 0.23
39 0.18
40 0.16
41 0.16
42 0.16
43 0.17
44 0.18
45 0.19
46 0.18
47 0.26
48 0.31
49 0.31
50 0.35
51 0.42
52 0.49
53 0.55
54 0.63
55 0.66
56 0.71
57 0.8
58 0.8
59 0.81
60 0.8
61 0.8
62 0.79
63 0.79
64 0.74
65 0.67
66 0.61