Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P9A9

Protein Details
Accession J3P9A9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
2-22GNGNRAQQKRDRNAKDQKGVQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039713  At2g23090-like  
IPR039438  At2g23090-like_Znf  
IPR007513  SERF-like_N  
IPR026939  ZNF706/At2g23090_sf  
Pfam View protein in Pfam  
PF04419  4F5  
PF12907  zf-met2  
Amino Acid Sequences MGNGNRAQQKRDRNAKDQKGVQKSQLKVNEQAKNIQCEVCKATFLTTTREPQLLLHSDNKHSKTVAECFPTYGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.82
4 0.8
5 0.79
6 0.76
7 0.72
8 0.7
9 0.67
10 0.6
11 0.59
12 0.58
13 0.52
14 0.51
15 0.57
16 0.54
17 0.48
18 0.53
19 0.47
20 0.44
21 0.41
22 0.35
23 0.27
24 0.23
25 0.25
26 0.18
27 0.16
28 0.13
29 0.13
30 0.15
31 0.16
32 0.2
33 0.2
34 0.23
35 0.25
36 0.25
37 0.24
38 0.21
39 0.25
40 0.23
41 0.23
42 0.27
43 0.28
44 0.34
45 0.41
46 0.43
47 0.39
48 0.36
49 0.36
50 0.34
51 0.37
52 0.38
53 0.36
54 0.35