Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N3NHI0

Protein Details
Accession A0A2N3NHI0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-21AKSARASSRKVNNQRLKANVHydrophilic
83-110KAEVRRTSKKLLKLKKRRKSSIVFPKYGHydrophilic
NLS Segment(s)
PositionSequence
87-118RRTSKKLLKLKKRRKSSIVFPKYGDRKIKSRK
Subcellular Location(s) mito_nucl 13.166, nucl 13, mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARASSRKVNNQRLKANVFGPVEAARAERLSAKLMELASQPKPQRDTEMKADDIESDDGDASSKQAADSTEMDVDSTASKAEVRRTSKKLLKLKKRRKSSIVFPKYGDRKIKSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.8
4 0.73
5 0.66
6 0.57
7 0.54
8 0.45
9 0.36
10 0.31
11 0.25
12 0.22
13 0.18
14 0.18
15 0.11
16 0.1
17 0.11
18 0.11
19 0.11
20 0.13
21 0.13
22 0.12
23 0.14
24 0.13
25 0.14
26 0.14
27 0.16
28 0.17
29 0.22
30 0.24
31 0.25
32 0.28
33 0.27
34 0.32
35 0.33
36 0.36
37 0.37
38 0.4
39 0.37
40 0.34
41 0.34
42 0.27
43 0.24
44 0.19
45 0.12
46 0.07
47 0.07
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.04
55 0.06
56 0.06
57 0.08
58 0.1
59 0.11
60 0.11
61 0.11
62 0.11
63 0.1
64 0.1
65 0.08
66 0.07
67 0.05
68 0.05
69 0.06
70 0.08
71 0.15
72 0.22
73 0.29
74 0.36
75 0.41
76 0.5
77 0.55
78 0.63
79 0.66
80 0.7
81 0.74
82 0.78
83 0.84
84 0.85
85 0.89
86 0.89
87 0.88
88 0.85
89 0.85
90 0.85
91 0.83
92 0.77
93 0.69
94 0.71
95 0.69
96 0.69
97 0.67
98 0.61