Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N3MXP7

Protein Details
Accession A0A2N3MXP7    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPKKRKNNGRNKKGRGHVKPIRCSNCSBasic
82-112GKIVRVRSREGRKNRAPPPRVRYNKDGKKIVBasic
NLS Segment(s)
PositionSequence
3-19KKRKNNGRNKKGRGHVK
86-110RVRSREGRKNRAPPPRVRYNKDGKK
Subcellular Location(s) mito 14, nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRKNNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAATRDILEASVFGSDYPVPKMYLKLQYCVSCAIHGKIVRVRSREGRKNRAPPPRVRYNKDGKKIVPTQGKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.85
4 0.83
5 0.82
6 0.83
7 0.83
8 0.8
9 0.73
10 0.72
11 0.69
12 0.69
13 0.68
14 0.66
15 0.63
16 0.64
17 0.68
18 0.69
19 0.71
20 0.7
21 0.72
22 0.73
23 0.75
24 0.71
25 0.72
26 0.67
27 0.67
28 0.59
29 0.51
30 0.45
31 0.36
32 0.33
33 0.26
34 0.25
35 0.16
36 0.15
37 0.13
38 0.11
39 0.11
40 0.1
41 0.09
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.07
51 0.08
52 0.09
53 0.09
54 0.11
55 0.15
56 0.23
57 0.23
58 0.25
59 0.27
60 0.27
61 0.28
62 0.29
63 0.26
64 0.19
65 0.2
66 0.19
67 0.2
68 0.2
69 0.22
70 0.23
71 0.29
72 0.32
73 0.33
74 0.36
75 0.41
76 0.5
77 0.56
78 0.62
79 0.66
80 0.7
81 0.77
82 0.82
83 0.83
84 0.8
85 0.81
86 0.8
87 0.81
88 0.8
89 0.78
90 0.78
91 0.78
92 0.81
93 0.8
94 0.79
95 0.71
96 0.71
97 0.71
98 0.71