Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NRX5

Protein Details
Accession J3NRX5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-57ANLLRAFKKRPGKKPKNKKPKIEGKKKDRFKVGBasic
NLS Segment(s)
PositionSequence
30-60AFKKRPGKKPKNKKPKIEGKKKDRFKVGKPP
Subcellular Location(s) mito 18.5, cyto_mito 11, nucl 6
Family & Domain DBs
Amino Acid Sequences MVGLTGLAFRLKLPVNYRIYNVFPANLLRAFKKRPGKKPKNKKPKIEGKKKDRFKVGKPPNGTADGLKRLNNGKCMLAVFKFIGGRKKSILKLFIGALKFSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.37
4 0.39
5 0.39
6 0.39
7 0.39
8 0.36
9 0.27
10 0.22
11 0.22
12 0.22
13 0.21
14 0.2
15 0.19
16 0.23
17 0.25
18 0.32
19 0.41
20 0.47
21 0.55
22 0.65
23 0.73
24 0.79
25 0.88
26 0.91
27 0.92
28 0.92
29 0.91
30 0.9
31 0.9
32 0.9
33 0.89
34 0.88
35 0.87
36 0.89
37 0.86
38 0.81
39 0.79
40 0.73
41 0.68
42 0.69
43 0.68
44 0.66
45 0.61
46 0.59
47 0.53
48 0.51
49 0.46
50 0.37
51 0.31
52 0.3
53 0.29
54 0.26
55 0.26
56 0.29
57 0.31
58 0.33
59 0.3
60 0.25
61 0.24
62 0.25
63 0.25
64 0.19
65 0.2
66 0.16
67 0.17
68 0.19
69 0.21
70 0.28
71 0.28
72 0.3
73 0.32
74 0.39
75 0.42
76 0.45
77 0.46
78 0.4
79 0.41
80 0.41
81 0.42
82 0.37