Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N3N354

Protein Details
Accession A0A2N3N354    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
72-91MIRSNRKKAAKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
76-91NRKKAAKAKAAAKKKA
Subcellular Location(s) plas 19, E.R. 4, vacu 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MHRLQLDKLVGLAMLVAASVVFLYYTLWVLPFVDDDHVLQTIFPPRVWAIRIPVILILLGSAVVGSFIGMVMIRSNRKKAAKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.03
11 0.04
12 0.04
13 0.04
14 0.05
15 0.05
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.07
22 0.07
23 0.08
24 0.08
25 0.08
26 0.07
27 0.08
28 0.11
29 0.12
30 0.11
31 0.11
32 0.11
33 0.13
34 0.14
35 0.14
36 0.13
37 0.16
38 0.16
39 0.15
40 0.15
41 0.14
42 0.12
43 0.11
44 0.07
45 0.04
46 0.03
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.03
57 0.03
58 0.05
59 0.1
60 0.16
61 0.2
62 0.24
63 0.31
64 0.36
65 0.44
66 0.5
67 0.58
68 0.61
69 0.66
70 0.72
71 0.75