Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N3NKD0

Protein Details
Accession A0A2N3NKD0    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-31AKSKNSSQHNQSKKAHRNGIKKPKTQRYPSHydrophilic
NLS Segment(s)
PositionSequence
14-61KKAHRNGIKKPKTQRYPSLKGVDPKFRRNHRHALHGTMKALKELKEGK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKAHRNGIKKPKTQRYPSLKGVDPKFRRNHRHALHGTMKALKELKEGKRTTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.79
5 0.8
6 0.82
7 0.85
8 0.83
9 0.81
10 0.81
11 0.82
12 0.82
13 0.79
14 0.78
15 0.76
16 0.74
17 0.74
18 0.69
19 0.62
20 0.59
21 0.57
22 0.57
23 0.52
24 0.53
25 0.55
26 0.58
27 0.64
28 0.63
29 0.69
30 0.63
31 0.68
32 0.63
33 0.63
34 0.62
35 0.57
36 0.54
37 0.48
38 0.45
39 0.39
40 0.39
41 0.31
42 0.31
43 0.36
44 0.41
45 0.46