Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NIH8

Protein Details
Accession J3NIH8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-39FPFVRACNRRPCRRHRGPVYSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MDATLPVPSCSPGWIPLFPFVRACNRRPCRRHRGPVYSGACIALPRGGLEPATRDDGVFNRQAPEGLPAAVSIVASRGRVWAAICHAGGWCEGCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.28
4 0.3
5 0.29
6 0.29
7 0.27
8 0.34
9 0.37
10 0.39
11 0.43
12 0.5
13 0.59
14 0.65
15 0.72
16 0.72
17 0.78
18 0.84
19 0.83
20 0.83
21 0.77
22 0.79
23 0.73
24 0.63
25 0.53
26 0.43
27 0.33
28 0.24
29 0.2
30 0.1
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.08
38 0.09
39 0.12
40 0.11
41 0.11
42 0.12
43 0.13
44 0.16
45 0.16
46 0.15
47 0.14
48 0.14
49 0.14
50 0.14
51 0.15
52 0.13
53 0.11
54 0.1
55 0.08
56 0.09
57 0.09
58 0.08
59 0.05
60 0.06
61 0.07
62 0.08
63 0.08
64 0.09
65 0.09
66 0.1
67 0.11
68 0.13
69 0.17
70 0.2
71 0.2
72 0.2
73 0.2
74 0.19
75 0.19