Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N3NBG7

Protein Details
Accession A0A2N3NBG7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
357-382EKVEKEQAVKRAKHKKREEELAKEAEBasic
401-423KQKEKEKDGAPAKTRKRAKKAGSBasic
NLS Segment(s)
PositionSequence
366-375KRAKHKKREE
397-423IKKGKQKEKEKDGAPAKTRKRAKKAGS
Subcellular Location(s) plas 10, mito 5.5, E.R. 5, cyto_mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00106  adh_short  
Amino Acid Sequences MPIHFVFYVIENGPPPWLRNNASLIIKTVASLVFLTLFKRFMSGAKCTAERNMHGKVVMITGGTSGIGVHVTRELAKRGAQIVLLTQVAPSDPFLAEFIEDVREQSNNNLIYAEQVDLLSLHSIRQFATKWIDNSPPRRLDMIILGAATLTPPGNERRETAEGVEETWMVNYLANFHLLGILSPAIRAQPFDREVRIVIATCSSYIGSPPLKEKLGKKAWTPGKAYARSKLALMTFGRAYQKHLDAYKRPDELPMNARVIFVNPGLSRTPGMRRWLTRGSLWGLALYLIAYLPVWFLLKSPFYGAQSILYAAMESELGRGAGGKLIKECMEVDFARTDIDDEEVAKNLWEGTDKYIEKVEKEQAVKRAKHKKREEELAKEAEEAKKTEEIEALVDAIKKGKQKEKEKDGAPAKTRKRAKKAGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.23
4 0.29
5 0.3
6 0.34
7 0.38
8 0.4
9 0.43
10 0.42
11 0.39
12 0.35
13 0.31
14 0.27
15 0.24
16 0.17
17 0.14
18 0.13
19 0.11
20 0.11
21 0.12
22 0.14
23 0.14
24 0.15
25 0.13
26 0.15
27 0.15
28 0.17
29 0.21
30 0.25
31 0.29
32 0.32
33 0.34
34 0.34
35 0.4
36 0.41
37 0.4
38 0.41
39 0.39
40 0.37
41 0.35
42 0.35
43 0.3
44 0.26
45 0.22
46 0.16
47 0.12
48 0.1
49 0.1
50 0.08
51 0.07
52 0.05
53 0.05
54 0.06
55 0.05
56 0.06
57 0.07
58 0.08
59 0.11
60 0.14
61 0.16
62 0.18
63 0.2
64 0.22
65 0.23
66 0.23
67 0.21
68 0.19
69 0.17
70 0.18
71 0.16
72 0.13
73 0.11
74 0.1
75 0.09
76 0.09
77 0.09
78 0.08
79 0.08
80 0.08
81 0.09
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.09
88 0.09
89 0.1
90 0.1
91 0.1
92 0.12
93 0.18
94 0.16
95 0.16
96 0.16
97 0.14
98 0.16
99 0.16
100 0.15
101 0.09
102 0.08
103 0.08
104 0.08
105 0.08
106 0.08
107 0.07
108 0.07
109 0.08
110 0.09
111 0.09
112 0.12
113 0.12
114 0.15
115 0.21
116 0.24
117 0.24
118 0.27
119 0.35
120 0.39
121 0.44
122 0.48
123 0.45
124 0.43
125 0.42
126 0.39
127 0.33
128 0.29
129 0.26
130 0.19
131 0.15
132 0.13
133 0.11
134 0.11
135 0.09
136 0.07
137 0.04
138 0.03
139 0.06
140 0.1
141 0.13
142 0.14
143 0.16
144 0.21
145 0.24
146 0.25
147 0.24
148 0.24
149 0.21
150 0.2
151 0.2
152 0.14
153 0.11
154 0.1
155 0.1
156 0.06
157 0.06
158 0.06
159 0.07
160 0.07
161 0.08
162 0.08
163 0.07
164 0.08
165 0.07
166 0.07
167 0.06
168 0.06
169 0.05
170 0.05
171 0.06
172 0.05
173 0.06
174 0.07
175 0.07
176 0.11
177 0.14
178 0.16
179 0.17
180 0.17
181 0.17
182 0.18
183 0.17
184 0.13
185 0.1
186 0.09
187 0.09
188 0.08
189 0.08
190 0.07
191 0.06
192 0.06
193 0.09
194 0.09
195 0.09
196 0.11
197 0.13
198 0.15
199 0.18
200 0.2
201 0.27
202 0.33
203 0.35
204 0.34
205 0.41
206 0.45
207 0.48
208 0.48
209 0.46
210 0.47
211 0.51
212 0.52
213 0.47
214 0.44
215 0.39
216 0.36
217 0.31
218 0.23
219 0.21
220 0.19
221 0.17
222 0.15
223 0.17
224 0.19
225 0.17
226 0.2
227 0.19
228 0.21
229 0.21
230 0.25
231 0.27
232 0.3
233 0.36
234 0.39
235 0.38
236 0.36
237 0.37
238 0.35
239 0.35
240 0.33
241 0.31
242 0.28
243 0.26
244 0.26
245 0.22
246 0.21
247 0.18
248 0.14
249 0.14
250 0.11
251 0.13
252 0.13
253 0.14
254 0.14
255 0.15
256 0.2
257 0.2
258 0.26
259 0.29
260 0.3
261 0.36
262 0.4
263 0.4
264 0.35
265 0.35
266 0.32
267 0.3
268 0.28
269 0.22
270 0.16
271 0.14
272 0.13
273 0.09
274 0.06
275 0.04
276 0.04
277 0.03
278 0.03
279 0.03
280 0.04
281 0.04
282 0.04
283 0.05
284 0.08
285 0.09
286 0.1
287 0.13
288 0.15
289 0.16
290 0.17
291 0.17
292 0.15
293 0.15
294 0.15
295 0.13
296 0.1
297 0.08
298 0.07
299 0.07
300 0.05
301 0.05
302 0.05
303 0.05
304 0.05
305 0.05
306 0.05
307 0.05
308 0.08
309 0.09
310 0.1
311 0.11
312 0.13
313 0.13
314 0.14
315 0.14
316 0.13
317 0.17
318 0.16
319 0.17
320 0.16
321 0.16
322 0.15
323 0.14
324 0.14
325 0.1
326 0.11
327 0.09
328 0.1
329 0.11
330 0.12
331 0.12
332 0.11
333 0.11
334 0.09
335 0.09
336 0.1
337 0.1
338 0.14
339 0.22
340 0.23
341 0.24
342 0.29
343 0.3
344 0.3
345 0.34
346 0.36
347 0.34
348 0.38
349 0.43
350 0.46
351 0.54
352 0.57
353 0.62
354 0.67
355 0.69
356 0.76
357 0.8
358 0.83
359 0.82
360 0.87
361 0.87
362 0.84
363 0.83
364 0.78
365 0.68
366 0.59
367 0.54
368 0.48
369 0.41
370 0.34
371 0.3
372 0.28
373 0.28
374 0.28
375 0.26
376 0.22
377 0.2
378 0.2
379 0.17
380 0.15
381 0.16
382 0.14
383 0.15
384 0.18
385 0.21
386 0.28
387 0.36
388 0.44
389 0.53
390 0.64
391 0.71
392 0.77
393 0.76
394 0.79
395 0.79
396 0.78
397 0.76
398 0.75
399 0.73
400 0.74
401 0.8
402 0.8
403 0.82