Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P9K5

Protein Details
Accession J3P9K5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-22KAEKDIKRVIPRQQRRGWNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MVKAEKDIKRVIPRQQRRGWNLIYRAQSKLLQSSKPGIRQIYKPATYFWEHAAECDDREAPNAASPARADGSRRDRLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.8
4 0.77
5 0.77
6 0.73
7 0.69
8 0.64
9 0.61
10 0.58
11 0.51
12 0.47
13 0.43
14 0.39
15 0.33
16 0.35
17 0.32
18 0.27
19 0.26
20 0.31
21 0.32
22 0.34
23 0.35
24 0.3
25 0.3
26 0.31
27 0.37
28 0.37
29 0.36
30 0.33
31 0.31
32 0.32
33 0.31
34 0.3
35 0.25
36 0.23
37 0.21
38 0.21
39 0.23
40 0.2
41 0.18
42 0.19
43 0.17
44 0.12
45 0.14
46 0.16
47 0.13
48 0.15
49 0.17
50 0.15
51 0.15
52 0.16
53 0.17
54 0.17
55 0.17
56 0.16
57 0.24
58 0.32
59 0.4