Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N3N3M4

Protein Details
Accession A0A2N3N3M4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
95-114YAHGDRKQDEKERLRRNRWNBasic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 7, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPTGLATLIVALHGRPLQPLPLLFAPVLLFSSYVNLAGFPTDSAGITAAWSGLYVLLALRRRQSLRNKLTVRGVVRGSAIGLGLINFASGAWVYAHGDRKQDEKERLRRNRWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.12
5 0.13
6 0.15
7 0.16
8 0.18
9 0.18
10 0.19
11 0.17
12 0.17
13 0.15
14 0.13
15 0.14
16 0.09
17 0.08
18 0.06
19 0.08
20 0.07
21 0.08
22 0.07
23 0.06
24 0.06
25 0.06
26 0.07
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.06
33 0.05
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.06
45 0.09
46 0.1
47 0.11
48 0.14
49 0.16
50 0.23
51 0.32
52 0.4
53 0.44
54 0.53
55 0.53
56 0.54
57 0.56
58 0.55
59 0.47
60 0.41
61 0.35
62 0.27
63 0.25
64 0.22
65 0.17
66 0.12
67 0.1
68 0.06
69 0.06
70 0.05
71 0.05
72 0.04
73 0.04
74 0.03
75 0.03
76 0.04
77 0.04
78 0.04
79 0.04
80 0.06
81 0.08
82 0.12
83 0.19
84 0.21
85 0.25
86 0.25
87 0.3
88 0.37
89 0.43
90 0.49
91 0.53
92 0.61
93 0.69
94 0.78