Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N3N1G0

Protein Details
Accession A0A2N3N1G0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
59-82QAYRDCKKAWLEKKKAERKKVSLWHydrophilic
NLS Segment(s)
PositionSequence
71-78KKKAERKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MASANSESPDHPWSEDNKSKFQTKARSEYFDPCQEAASRSIKCLHRNGGDRTMCGEYFQAYRDCKKAWLEKKKAERKKVSLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.38
4 0.42
5 0.45
6 0.47
7 0.49
8 0.51
9 0.52
10 0.51
11 0.57
12 0.54
13 0.56
14 0.54
15 0.56
16 0.54
17 0.49
18 0.45
19 0.36
20 0.32
21 0.28
22 0.26
23 0.24
24 0.24
25 0.19
26 0.18
27 0.24
28 0.26
29 0.29
30 0.31
31 0.32
32 0.33
33 0.39
34 0.42
35 0.45
36 0.42
37 0.39
38 0.39
39 0.37
40 0.3
41 0.25
42 0.21
43 0.14
44 0.14
45 0.16
46 0.18
47 0.18
48 0.21
49 0.24
50 0.25
51 0.27
52 0.33
53 0.41
54 0.46
55 0.55
56 0.61
57 0.67
58 0.77
59 0.84
60 0.87
61 0.88
62 0.88