Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3NLT5

Protein Details
Accession J3NLT5    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
24-49LKPVSDIRARKNRRRRAPITGARKKDBasic
NLS Segment(s)
PositionSequence
31-48RARKNRRRRAPITGARKK
Subcellular Location(s) mito 11, cyto 9.5, cyto_nucl 9, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MTKQAIALIQAVNKADKTKLVQALKPVSDIRARKNRRRRAPITGARKKDVLDVIELLRQTKVEASLFTILDISPPMREEIRVLDQAGSQDGTVGSACQVPRATGFPRLFMLCLCRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.19
4 0.22
5 0.27
6 0.34
7 0.37
8 0.38
9 0.43
10 0.49
11 0.46
12 0.44
13 0.37
14 0.32
15 0.34
16 0.35
17 0.37
18 0.41
19 0.49
20 0.56
21 0.66
22 0.73
23 0.77
24 0.84
25 0.81
26 0.8
27 0.83
28 0.82
29 0.82
30 0.81
31 0.75
32 0.67
33 0.62
34 0.53
35 0.45
36 0.38
37 0.28
38 0.2
39 0.17
40 0.16
41 0.17
42 0.16
43 0.13
44 0.11
45 0.1
46 0.08
47 0.08
48 0.08
49 0.07
50 0.07
51 0.09
52 0.11
53 0.11
54 0.11
55 0.11
56 0.09
57 0.09
58 0.09
59 0.07
60 0.05
61 0.06
62 0.08
63 0.08
64 0.08
65 0.09
66 0.13
67 0.17
68 0.18
69 0.18
70 0.18
71 0.18
72 0.18
73 0.19
74 0.15
75 0.1
76 0.09
77 0.08
78 0.08
79 0.07
80 0.07
81 0.06
82 0.09
83 0.09
84 0.12
85 0.13
86 0.13
87 0.15
88 0.19
89 0.21
90 0.26
91 0.27
92 0.27
93 0.3
94 0.3
95 0.29
96 0.26