Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N3NLQ9

Protein Details
Accession A0A2N3NLQ9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-88RFKTMEKCDWLNRKRCCCKKHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, mito 6, plas 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MKLSGLLFVATLAAGVLASPAAQPPTSANPQLDTRAVLEDRANKCMATSDCSWGYAGKCEQFCRVLGYRFKTMEKCDWLNRKRCCCKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.06
9 0.06
10 0.06
11 0.09
12 0.15
13 0.18
14 0.2
15 0.2
16 0.21
17 0.23
18 0.25
19 0.23
20 0.18
21 0.15
22 0.16
23 0.16
24 0.14
25 0.14
26 0.2
27 0.21
28 0.23
29 0.22
30 0.19
31 0.19
32 0.22
33 0.21
34 0.17
35 0.17
36 0.18
37 0.18
38 0.19
39 0.19
40 0.17
41 0.17
42 0.16
43 0.17
44 0.17
45 0.18
46 0.19
47 0.22
48 0.22
49 0.22
50 0.24
51 0.26
52 0.28
53 0.32
54 0.36
55 0.4
56 0.41
57 0.44
58 0.42
59 0.44
60 0.45
61 0.46
62 0.47
63 0.5
64 0.58
65 0.63
66 0.68
67 0.73
68 0.76