Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N3NAA6

Protein Details
Accession A0A2N3NAA6   
Localization Confidence High
Confidence Score 26.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-51AQAYTGEKTKKRRKDGDGSEKKKSKRLRELKKDIVDLPBasic
74-99EGEALSKKAEKKRRKKELAERELKNGBasic
117-144EGNPIEGKKSKKNKKKKKTKDAANEEEGBasic
267-312GGKTSNRMDKIKRKNEKLNANRLKRIEQEKEEKKHKAKETNGNGGAHydrophilic
NLS Segment(s)
PositionSequence
21-45KTKKRRKDGDGSEKKKSKRLRELKK
80-91KKAEKKRRKKEL
123-136GKKSKKNKKKKKTK
273-304RMDKIKRKNEKLNANRLKRIEQEKEEKKHKAK
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034228  Nop6_RRM  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12400  RRM_Nop6  
Amino Acid Sequences MGKRSRDCLGDSSAQAYTGEKTKKRRKDGDGSEKKKSKRLRELKKDIVDLPEDDKEELAEESVVGRISADANGEGEALSKKAEKKRRKKELAERELKNGAGHEVEEQLVQGQDDENEGNPIEGKKSKKNKKKKKTKDAANEEEGGVKVTNQEEPKANMATKEAGGVEEDGDESLTQGKAPRFIVFVGNLPYSATAESIGAHFASLNPAQVRCLTKRDDPTKCRGCAFIDFTSSKDMRTCLDKMHHSTFNDGISKPRKINVELTAGGGGKTSNRMDKIKRKNEKLNANRLKRIEQEKEEKKHKAKETNGNGGAEDSMHPSRRARLPGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.24
4 0.2
5 0.22
6 0.29
7 0.32
8 0.42
9 0.52
10 0.62
11 0.71
12 0.78
13 0.79
14 0.82
15 0.87
16 0.88
17 0.89
18 0.86
19 0.86
20 0.84
21 0.79
22 0.76
23 0.73
24 0.73
25 0.73
26 0.77
27 0.78
28 0.81
29 0.88
30 0.9
31 0.88
32 0.81
33 0.73
34 0.66
35 0.58
36 0.48
37 0.42
38 0.36
39 0.3
40 0.26
41 0.23
42 0.19
43 0.17
44 0.16
45 0.12
46 0.08
47 0.07
48 0.07
49 0.08
50 0.08
51 0.06
52 0.06
53 0.06
54 0.07
55 0.08
56 0.08
57 0.07
58 0.08
59 0.08
60 0.08
61 0.07
62 0.08
63 0.08
64 0.07
65 0.08
66 0.11
67 0.17
68 0.26
69 0.36
70 0.45
71 0.56
72 0.67
73 0.77
74 0.83
75 0.87
76 0.9
77 0.92
78 0.92
79 0.9
80 0.82
81 0.76
82 0.68
83 0.59
84 0.48
85 0.37
86 0.27
87 0.18
88 0.16
89 0.11
90 0.1
91 0.1
92 0.09
93 0.08
94 0.08
95 0.07
96 0.07
97 0.06
98 0.05
99 0.05
100 0.06
101 0.07
102 0.06
103 0.07
104 0.07
105 0.07
106 0.08
107 0.08
108 0.1
109 0.14
110 0.17
111 0.26
112 0.37
113 0.47
114 0.56
115 0.67
116 0.76
117 0.82
118 0.9
119 0.92
120 0.93
121 0.93
122 0.93
123 0.93
124 0.92
125 0.87
126 0.79
127 0.69
128 0.58
129 0.48
130 0.38
131 0.28
132 0.18
133 0.11
134 0.09
135 0.08
136 0.11
137 0.11
138 0.13
139 0.13
140 0.15
141 0.18
142 0.18
143 0.18
144 0.14
145 0.15
146 0.14
147 0.12
148 0.12
149 0.09
150 0.08
151 0.08
152 0.07
153 0.06
154 0.05
155 0.05
156 0.04
157 0.04
158 0.04
159 0.04
160 0.05
161 0.05
162 0.05
163 0.08
164 0.09
165 0.12
166 0.13
167 0.13
168 0.13
169 0.14
170 0.15
171 0.13
172 0.14
173 0.14
174 0.14
175 0.13
176 0.12
177 0.11
178 0.1
179 0.09
180 0.08
181 0.05
182 0.05
183 0.06
184 0.06
185 0.06
186 0.05
187 0.05
188 0.05
189 0.04
190 0.08
191 0.08
192 0.1
193 0.1
194 0.11
195 0.11
196 0.15
197 0.19
198 0.18
199 0.22
200 0.24
201 0.29
202 0.38
203 0.46
204 0.52
205 0.52
206 0.6
207 0.64
208 0.62
209 0.57
210 0.5
211 0.44
212 0.41
213 0.42
214 0.33
215 0.31
216 0.29
217 0.29
218 0.33
219 0.31
220 0.26
221 0.22
222 0.21
223 0.17
224 0.22
225 0.22
226 0.2
227 0.27
228 0.32
229 0.36
230 0.42
231 0.45
232 0.41
233 0.44
234 0.41
235 0.38
236 0.36
237 0.3
238 0.32
239 0.33
240 0.36
241 0.34
242 0.37
243 0.37
244 0.36
245 0.42
246 0.38
247 0.39
248 0.35
249 0.35
250 0.33
251 0.29
252 0.26
253 0.2
254 0.16
255 0.1
256 0.14
257 0.15
258 0.18
259 0.22
260 0.28
261 0.37
262 0.47
263 0.57
264 0.64
265 0.72
266 0.76
267 0.82
268 0.85
269 0.87
270 0.86
271 0.87
272 0.86
273 0.84
274 0.82
275 0.76
276 0.72
277 0.69
278 0.69
279 0.66
280 0.64
281 0.67
282 0.7
283 0.76
284 0.79
285 0.8
286 0.79
287 0.8
288 0.8
289 0.79
290 0.79
291 0.8
292 0.81
293 0.82
294 0.78
295 0.7
296 0.61
297 0.52
298 0.43
299 0.33
300 0.25
301 0.2
302 0.2
303 0.22
304 0.24
305 0.26
306 0.33
307 0.39