Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N3N994

Protein Details
Accession A0A2N3N994    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-51FGMTDNRHLRRRRHRLNRRPRPELLBasic
NLS Segment(s)
PositionSequence
34-48HLRRRRHRLNRRPRP
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTADALVAKLKGLRTRALKPFYLTATFGMTDNRHLRRRRHRLNRRPRPELLSQLPRRPIRNSAWFASAVSIDPGYLRNDDSDASLVTDSTDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.47
4 0.49
5 0.48
6 0.47
7 0.48
8 0.44
9 0.41
10 0.33
11 0.26
12 0.23
13 0.22
14 0.19
15 0.18
16 0.15
17 0.19
18 0.24
19 0.29
20 0.34
21 0.39
22 0.48
23 0.56
24 0.67
25 0.72
26 0.77
27 0.82
28 0.86
29 0.92
30 0.94
31 0.91
32 0.87
33 0.78
34 0.72
35 0.65
36 0.61
37 0.56
38 0.56
39 0.51
40 0.5
41 0.54
42 0.52
43 0.51
44 0.47
45 0.46
46 0.42
47 0.47
48 0.47
49 0.42
50 0.41
51 0.38
52 0.36
53 0.31
54 0.25
55 0.16
56 0.13
57 0.1
58 0.08
59 0.08
60 0.09
61 0.1
62 0.11
63 0.11
64 0.11
65 0.12
66 0.13
67 0.14
68 0.14
69 0.13
70 0.13
71 0.13
72 0.12