J3P9V0

UniProt ID: J3P9V0   Organism: Gaeumannomyces tritici (strain R3-111a-1)
Gene: 20350732   Protein: 60S ribosomal protein L35
Length: 150 AA

Protein Details

• Accession: J3P9V0
• Localization Confidence: Medium
• Confidence Score: 10.4
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  100-123	DASRVLEKTRKRQQHFSQRTYFVK	Hydrophilic

• Subcellular Location(s): nucl 20, cyto_nucl 12, mito 5
• Family & Domain DBs:
  • InterPro:
    • IPR001854 Ribosomal_L29/L35
    • IPR036049 Ribosomal_L29/L35_sf
    • IPR045059 RL35
  • Gene Ontology:
    • GO:0022625 C:cytosolic large ribosomal subunit
    • GO:0003735 F:structural constituent of ribosome
    • GO:0000463 P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
    • GO:0006412 P:translation
  • Pfam:
    • PF00831 Ribosomal_L29
  • CDD:
    • cd00427 Ribosomal_L29_HIP
• Amino Acid Sequences: MSTAKVKAGALWGKDKDELTKQLSELKTELNQLRIQKIASSGTKLNKIHDLRKSIARVLTVINLKQRSQLRLFYKNKTYLPLDLRAKQTRAIRRQLSKEDASRVLEKTRKRQQHFSQRTYFVKAE

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.36
2, 0.36
3, 0.33
4, 0.34
5, 0.36
6, 0.33
7, 0.33
8, 0.32
9, 0.37
10, 0.37
11, 0.35
12, 0.3
13, 0.27
14, 0.25
15, 0.29
16, 0.3
17, 0.25
18, 0.28
19, 0.28
20, 0.3
21, 0.28
22, 0.26
23, 0.21
24, 0.21
25, 0.22
26, 0.2
27, 0.21
28, 0.23
29, 0.25
30, 0.32
31, 0.31
32, 0.31
33, 0.35
34, 0.37
35, 0.4
36, 0.41
37, 0.42
38, 0.38
39, 0.43
40, 0.43
41, 0.37
42, 0.35
43, 0.29
44, 0.24
45, 0.2
46, 0.21
47, 0.17
48, 0.17
49, 0.19
50, 0.19
51, 0.19
52, 0.24
53, 0.25
54, 0.25
55, 0.26
56, 0.32
57, 0.33
58, 0.42
59, 0.46
60, 0.46
61, 0.5
62, 0.51
63, 0.5
64, 0.47
65, 0.43
66, 0.38
67, 0.38
68, 0.4
69, 0.39
70, 0.38
71, 0.44
72, 0.45
73, 0.44
74, 0.43
75, 0.47
76, 0.49
77, 0.51
78, 0.55
79, 0.56
80, 0.59
81, 0.65
82, 0.67
83, 0.66
84, 0.63
85, 0.6
86, 0.56
87, 0.52
88, 0.49
89, 0.45
90, 0.4
91, 0.41
92, 0.41
93, 0.43
94, 0.48
95, 0.55
96, 0.61
97, 0.64
98, 0.73
99, 0.76
100, 0.82
101, 0.86
102, 0.84
103, 0.83
104, 0.8
105, 0.77