FuNGI

A0A2N3N9R1

Protein Details

Accession

A0A2N3N9R1

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
53-82	WGAPRLYGKGYKKRQLRHRRVSQVSQRAPE	Hydrophilic

NLS Segment(s)

Position	Sequence
63-69	YKKRQLR

Subcellular Location(s)

extr 12, cyto 4.5, plas 4, cyto_nucl 3.5, mito 2, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR002466 A_deamin IPR001128 Cyt_P450 IPR017972 Cyt_P450_CS IPR002403 Cyt_P450_E_grp-IV IPR036396 Cyt_P450_sf IPR042935 Tad1
Gene Ontology	GO:0020037 F:heme binding GO:0005506 F:iron ion binding GO:0004497 F:monooxygenase activity GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen GO:0003723 F:RNA binding GO:0008251 F:tRNA-specific adenosine deaminase activity GO:0002100 P:tRNA wobble adenosine to inosine editing
Pfam	View protein in Pfam PF02137 A_deamin PF00067 p450
PROSITE	View protein in PROSITE PS50141 A_DEAMIN_EDITASE PS00086 CYTOCHROME_P450
CDD	cd11041 CYP503A1-like

Amino Acid Sequences

MLSERWPLIIAGAAAFLGMTVLHYLCEWRVLTSIPHLGSEIGDVKKRRMAYIWGAPRLYGKGYKKRQLRHRRVSQVSQRAPETPLPDNVGSLQAALLEIVKAKHTNLSFENGMEIARIIKADLNPALVRLNPIIAEEVNEAFRRELQIGDDWTEFNCHGKVLGNISMISGKVVVGPELCHNEECLDAFIKYTTEVMTAPEDMLQWLMEAHLKPGKVDGIVCIEKLQFGLSFAAIHTGSLFTTKHALAESGGNFTSQALQKMKKLDNFLRETARVTPQGFTSFHRKLLKTITLSSGQVLPAGSKIEIPTISPNFDNDVFANSEKFDAFQYSRAREVALHEKGARAAGATAATQFISVSPTNLVFGYGRHACPGRFFAVNEIKIIVANVLLKSDVKNADPDAGRLPNVEFASMYTSDGTKSLLFRNIQLCPSSEGPAPTTAPSHADPRSVPKADQIASLVLQQFFSLPKKRKPAIRDTGVHEWTPLSSIVAERAGELRCLSIATGMKCLPAAKLKEASGNGLHDWHAEILAIRAFNHYLLSEAVKLSQSTGENGESFILQWATPADREAVSQPFTIRNDVKLYMYSSEAPCKNLYLPQSSSATSRTSLILIVSPPVQGGDASMELTMSAQEDPTPWVVPTSSDQGGAVPSASPSQLPGRQYFSNLGIVRRKPSRPDAPPTLSKSCSDKLALAQATSLLSSLASLLINPANAYLSALILPQPAYVPGAFQRCFSDRMGKVRNATWEGGYRFRPLNPLTTSVEFNFSKREVTARSGGKIAPCNVSAVWGTHSLEEGLVSGVIQGRKAFQERAASALSRRRLWELAVDAAGLLGEEGENIREALRGESYGSVKENGLLKARRRVKEAVWEEALKGWAKNAGDEGFTLGNNT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.08
2	0.07
3	0.06
4	0.04
5	0.04
6	0.04
7	0.05
8	0.06
9	0.06
10	0.07
11	0.09
12	0.09
13	0.14
14	0.14
15	0.13
16	0.15
17	0.16
18	0.18
19	0.22
20	0.28
21	0.24
22	0.24
23	0.23
24	0.22
25	0.21
26	0.23
27	0.23
28	0.21
29	0.26
30	0.27
31	0.3
32	0.34
33	0.36
34	0.34
35	0.32
36	0.35
37	0.38
38	0.46
39	0.52
40	0.54
41	0.52
42	0.51
43	0.49
44	0.45
45	0.41
46	0.39
47	0.39
48	0.43
49	0.53
50	0.61
51	0.67
52	0.74
53	0.81
54	0.84
55	0.86
56	0.87
57	0.88
58	0.9
59	0.9
60	0.91
61	0.9
62	0.89
63	0.85
64	0.79
65	0.71
66	0.63
67	0.59
68	0.52
69	0.47
70	0.4
71	0.36
72	0.36
73	0.34
74	0.32
75	0.29
76	0.27
77	0.22
78	0.18
79	0.14
80	0.09
81	0.09
82	0.08
83	0.07
84	0.06
85	0.07
86	0.08
87	0.11
88	0.11
89	0.12
90	0.18
91	0.18
92	0.23
93	0.24
94	0.29
95	0.27
96	0.27
97	0.27
98	0.21
99	0.21
100	0.16
101	0.14
102	0.09
103	0.08
104	0.08
105	0.07
106	0.11
107	0.11
108	0.16
109	0.16
110	0.19
111	0.19
112	0.2
113	0.21
114	0.18
115	0.2
116	0.16
117	0.16
118	0.12
119	0.13
120	0.13
121	0.12
122	0.14
123	0.13
124	0.14
125	0.15
126	0.16
127	0.16
128	0.15
129	0.16
130	0.17
131	0.16
132	0.15
133	0.15
134	0.19
135	0.2
136	0.23
137	0.23
138	0.2
139	0.2
140	0.21
141	0.19
142	0.16
143	0.15
144	0.11
145	0.11
146	0.13
147	0.15
148	0.16
149	0.2
150	0.19
151	0.18
152	0.19
153	0.19
154	0.17
155	0.15
156	0.12
157	0.08
158	0.08
159	0.09
160	0.09
161	0.08
162	0.09
163	0.13
164	0.18
165	0.19
166	0.17
167	0.18
168	0.18
169	0.18
170	0.17
171	0.15
172	0.12
173	0.11
174	0.11
175	0.11
176	0.11
177	0.1
178	0.1
179	0.09
180	0.08
181	0.09
182	0.1
183	0.11
184	0.11
185	0.11
186	0.11
187	0.11
188	0.1
189	0.1
190	0.08
191	0.06
192	0.06
193	0.06
194	0.09
195	0.09
196	0.12
197	0.14
198	0.14
199	0.14
200	0.16
201	0.17
202	0.14
203	0.14
204	0.13
205	0.17
206	0.18
207	0.18
208	0.18
209	0.17
210	0.16
211	0.16
212	0.15
213	0.08
214	0.09
215	0.09
216	0.08
217	0.08
218	0.08
219	0.11
220	0.1
221	0.09
222	0.08
223	0.08
224	0.07
225	0.09
226	0.1
227	0.08
228	0.11
229	0.11
230	0.12
231	0.12
232	0.12
233	0.11
234	0.15
235	0.15
236	0.15
237	0.15
238	0.14
239	0.13
240	0.13
241	0.17
242	0.14
243	0.18
244	0.2
245	0.22
246	0.25
247	0.32
248	0.37
249	0.36
250	0.42
251	0.43
252	0.47
253	0.5
254	0.5
255	0.47
256	0.44
257	0.42
258	0.38
259	0.37
260	0.32
261	0.28
262	0.25
263	0.22
264	0.25
265	0.24
266	0.24
267	0.28
268	0.27
269	0.32
270	0.38
271	0.37
272	0.35
273	0.41
274	0.44
275	0.38
276	0.38
277	0.35
278	0.31
279	0.31
280	0.29
281	0.24
282	0.18
283	0.16
284	0.14
285	0.1
286	0.09
287	0.1
288	0.09
289	0.08
290	0.08
291	0.09
292	0.1
293	0.1
294	0.15
295	0.16
296	0.17
297	0.17
298	0.17
299	0.18
300	0.18
301	0.18
302	0.13
303	0.14
304	0.14
305	0.14
306	0.14
307	0.11
308	0.12
309	0.1
310	0.11
311	0.09
312	0.11
313	0.11
314	0.17
315	0.21
316	0.22
317	0.24
318	0.23
319	0.23
320	0.21
321	0.24
322	0.27
323	0.24
324	0.25
325	0.24
326	0.24
327	0.24
328	0.23
329	0.19
330	0.1
331	0.08
332	0.06
333	0.06
334	0.06
335	0.06
336	0.06
337	0.06
338	0.06
339	0.05
340	0.05
341	0.07
342	0.07
343	0.08
344	0.08
345	0.08
346	0.09
347	0.09
348	0.1
349	0.07
350	0.07
351	0.11
352	0.13
353	0.13
354	0.14
355	0.15
356	0.14
357	0.16
358	0.19
359	0.16
360	0.15
361	0.15
362	0.21
363	0.27
364	0.27
365	0.25
366	0.23
367	0.2
368	0.19
369	0.19
370	0.12
371	0.05
372	0.06
373	0.06
374	0.06
375	0.06
376	0.06
377	0.07
378	0.1
379	0.11
380	0.1
381	0.12
382	0.12
383	0.16
384	0.16
385	0.17
386	0.16
387	0.16
388	0.15
389	0.15
390	0.15
391	0.14
392	0.14
393	0.13
394	0.1
395	0.09
396	0.12
397	0.12
398	0.12
399	0.08
400	0.08
401	0.08
402	0.09
403	0.09
404	0.07
405	0.08
406	0.1
407	0.14
408	0.14
409	0.16
410	0.2
411	0.2
412	0.21
413	0.2
414	0.19
415	0.18
416	0.19
417	0.18
418	0.16
419	0.15
420	0.15
421	0.15
422	0.15
423	0.12
424	0.12
425	0.1
426	0.12
427	0.12
428	0.15
429	0.14
430	0.15
431	0.15
432	0.2
433	0.26
434	0.24
435	0.23
436	0.22
437	0.25
438	0.24
439	0.24
440	0.19
441	0.14
442	0.13
443	0.15
444	0.13
445	0.1
446	0.1
447	0.09
448	0.08
449	0.09
450	0.13
451	0.18
452	0.22
453	0.28
454	0.35
455	0.39
456	0.44
457	0.48
458	0.55
459	0.56
460	0.58
461	0.57
462	0.55
463	0.59
464	0.55
465	0.49
466	0.39
467	0.3
468	0.23
469	0.21
470	0.15
471	0.07
472	0.06
473	0.06
474	0.07
475	0.07
476	0.07
477	0.06
478	0.09
479	0.09
480	0.09
481	0.09
482	0.08
483	0.07
484	0.07
485	0.07
486	0.08
487	0.1
488	0.11
489	0.13
490	0.13
491	0.13
492	0.13
493	0.14
494	0.12
495	0.15
496	0.16
497	0.16
498	0.19
499	0.2
500	0.23
501	0.23
502	0.24
503	0.2
504	0.19
505	0.17
506	0.15
507	0.15
508	0.11
509	0.11
510	0.09
511	0.07
512	0.06
513	0.06
514	0.06
515	0.07
516	0.07
517	0.06
518	0.07
519	0.07
520	0.07
521	0.08
522	0.07
523	0.07
524	0.07
525	0.08
526	0.08
527	0.08
528	0.09
529	0.09
530	0.09
531	0.09
532	0.11
533	0.1
534	0.11
535	0.13
536	0.13
537	0.12
538	0.13
539	0.12
540	0.09
541	0.09
542	0.09
543	0.07
544	0.06
545	0.06
546	0.07
547	0.07
548	0.08
549	0.08
550	0.08
551	0.08
552	0.09
553	0.11
554	0.13
555	0.14
556	0.14
557	0.15
558	0.18
559	0.19
560	0.23
561	0.21
562	0.21
563	0.22
564	0.23
565	0.23
566	0.2
567	0.2
568	0.16
569	0.17
570	0.18
571	0.17
572	0.22
573	0.23
574	0.23
575	0.22
576	0.22
577	0.21
578	0.22
579	0.23
580	0.22
581	0.22
582	0.24
583	0.25
584	0.25
585	0.25
586	0.23
587	0.22
588	0.17
589	0.17
590	0.14
591	0.13
592	0.12
593	0.11
594	0.11
595	0.09
596	0.1
597	0.09
598	0.09
599	0.08
600	0.08
601	0.08
602	0.06
603	0.06
604	0.06
605	0.06
606	0.07
607	0.07
608	0.06
609	0.06
610	0.06
611	0.06
612	0.05
613	0.05
614	0.05
615	0.05
616	0.06
617	0.08
618	0.09
619	0.1
620	0.09
621	0.1
622	0.1
623	0.11
624	0.13
625	0.17
626	0.16
627	0.15
628	0.15
629	0.15
630	0.15
631	0.14
632	0.11
633	0.06
634	0.06
635	0.07
636	0.07
637	0.07
638	0.08
639	0.13
640	0.16
641	0.19
642	0.21
643	0.25
644	0.26
645	0.28
646	0.29
647	0.26
648	0.31
649	0.3
650	0.32
651	0.34
652	0.36
653	0.39
654	0.43
655	0.44
656	0.42
657	0.5
658	0.54
659	0.54
660	0.6
661	0.63
662	0.63
663	0.67
664	0.68
665	0.65
666	0.57
667	0.52
668	0.49
669	0.42
670	0.39
671	0.33
672	0.28
673	0.25
674	0.31
675	0.29
676	0.24
677	0.22
678	0.2
679	0.18
680	0.17
681	0.14
682	0.06
683	0.05
684	0.05
685	0.05
686	0.05
687	0.05
688	0.05
689	0.07
690	0.08
691	0.08
692	0.08
693	0.08
694	0.08
695	0.08
696	0.09
697	0.07
698	0.06
699	0.07
700	0.07
701	0.07
702	0.08
703	0.08
704	0.07
705	0.08
706	0.08
707	0.09
708	0.09
709	0.1
710	0.14
711	0.2
712	0.2
713	0.21
714	0.26
715	0.26
716	0.29
717	0.3
718	0.35
719	0.32
720	0.41
721	0.47
722	0.46
723	0.47
724	0.48
725	0.52
726	0.47
727	0.44
728	0.38
729	0.38
730	0.37
731	0.39
732	0.37
733	0.34
734	0.32
735	0.32
736	0.36
737	0.3
738	0.35
739	0.32
740	0.35
741	0.36
742	0.36
743	0.38
744	0.33
745	0.38
746	0.31
747	0.29
748	0.29
749	0.25
750	0.24
751	0.22
752	0.25
753	0.22
754	0.27
755	0.34
756	0.33
757	0.34
758	0.35
759	0.36
760	0.37
761	0.39
762	0.37
763	0.32
764	0.29
765	0.29
766	0.27
767	0.27
768	0.23
769	0.19
770	0.18
771	0.18
772	0.19
773	0.17
774	0.18
775	0.15
776	0.14
777	0.13
778	0.11
779	0.08
780	0.07
781	0.06
782	0.07
783	0.1
784	0.11
785	0.12
786	0.12
787	0.14
788	0.19
789	0.23
790	0.24
791	0.24
792	0.32
793	0.32
794	0.35
795	0.36
796	0.33
797	0.34
798	0.4
799	0.41
800	0.36
801	0.38
802	0.38
803	0.37
804	0.37
805	0.38
806	0.34
807	0.32
808	0.29
809	0.26
810	0.21
811	0.2
812	0.18
813	0.11
814	0.07
815	0.04
816	0.03
817	0.03
818	0.04
819	0.05
820	0.06
821	0.06
822	0.07
823	0.08
824	0.09
825	0.11
826	0.13
827	0.13
828	0.14
829	0.18
830	0.2
831	0.21
832	0.22
833	0.22
834	0.2
835	0.24
836	0.27
837	0.26
838	0.33
839	0.37
840	0.41
841	0.49
842	0.58
843	0.58
844	0.59
845	0.61
846	0.59
847	0.63
848	0.62
849	0.6
850	0.56
851	0.53
852	0.48
853	0.46
854	0.44
855	0.34
856	0.29
857	0.23
858	0.22
859	0.21
860	0.22
861	0.23
862	0.21
863	0.2
864	0.2
865	0.22
866	0.19

A0A2N3N9R1

3D AlphaFold-predicted Structure Viewer