Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N3NCH5

Protein Details
Accession A0A2N3NCH5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
444-466VPTPEARKMRRHMHKHAARHGARBasic
NLS Segment(s)
PositionSequence
450-463RKMRRHMHKHAARH
Subcellular Location(s) extr 24, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018535  DUF1996  
Pfam View protein in Pfam  
PF09362  DUF1996  
Amino Acid Sequences MRYSTIMGAAMFGAALAAKDSRTFSVMRFNGKEIFNGRVDPIVNPGGTSPHEHTVFGGSAFGPDATGASMAQSKCTNAKLKGDKSAYWAPRLYFHDKAAGTFEPVPVFYTNIYYFFDATDDDIKAFPQGLSILAGDTKTRTAPETGGSANLDPKDGPINNIMWTCPRDNLDVPGWPVGSDGTTAGMQDPNNKGQGVGFPSANCDGFASPLRADIHFPSCYNPEAGLTNYQENMAWPSSKGASAGGRVNCPEGYIHVPHLFMEVYWDTPSFSDRWTPSESGEQPFVLSNGDVTGYSLHADFLAAWDEDLLQNIIDNCNTAHAGMETCPGVADQVNTEECECENAATFRTASTGSITALPGDNPLSGFKYGAAPASSGSSTNDTPVSNSSDEDDSEEVDITEQDAQAAQPESPAVTGAPEPNKPAPVCVTRTKTVVETVTVYEDAVPTPEARKMRRHMHKHAARHGARMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.06
5 0.06
6 0.08
7 0.11
8 0.12
9 0.15
10 0.16
11 0.16
12 0.26
13 0.29
14 0.36
15 0.36
16 0.38
17 0.42
18 0.42
19 0.45
20 0.37
21 0.39
22 0.32
23 0.31
24 0.29
25 0.26
26 0.26
27 0.22
28 0.24
29 0.23
30 0.21
31 0.19
32 0.19
33 0.18
34 0.19
35 0.23
36 0.22
37 0.25
38 0.27
39 0.26
40 0.27
41 0.27
42 0.27
43 0.22
44 0.19
45 0.12
46 0.12
47 0.12
48 0.12
49 0.08
50 0.07
51 0.07
52 0.06
53 0.07
54 0.06
55 0.07
56 0.12
57 0.12
58 0.15
59 0.16
60 0.17
61 0.2
62 0.26
63 0.31
64 0.3
65 0.39
66 0.46
67 0.49
68 0.57
69 0.57
70 0.53
71 0.53
72 0.59
73 0.52
74 0.48
75 0.46
76 0.38
77 0.41
78 0.46
79 0.45
80 0.39
81 0.37
82 0.4
83 0.37
84 0.37
85 0.34
86 0.29
87 0.26
88 0.24
89 0.24
90 0.18
91 0.18
92 0.19
93 0.15
94 0.16
95 0.12
96 0.15
97 0.14
98 0.15
99 0.17
100 0.15
101 0.15
102 0.14
103 0.14
104 0.11
105 0.12
106 0.13
107 0.12
108 0.12
109 0.11
110 0.11
111 0.11
112 0.12
113 0.09
114 0.07
115 0.07
116 0.07
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.08
123 0.08
124 0.09
125 0.08
126 0.09
127 0.1
128 0.11
129 0.12
130 0.13
131 0.15
132 0.14
133 0.15
134 0.16
135 0.15
136 0.16
137 0.16
138 0.15
139 0.12
140 0.12
141 0.16
142 0.15
143 0.16
144 0.16
145 0.17
146 0.18
147 0.19
148 0.18
149 0.16
150 0.19
151 0.18
152 0.18
153 0.18
154 0.19
155 0.2
156 0.23
157 0.22
158 0.21
159 0.22
160 0.21
161 0.19
162 0.16
163 0.15
164 0.11
165 0.1
166 0.07
167 0.06
168 0.06
169 0.06
170 0.06
171 0.07
172 0.09
173 0.08
174 0.14
175 0.16
176 0.17
177 0.18
178 0.18
179 0.17
180 0.16
181 0.19
182 0.17
183 0.16
184 0.15
185 0.13
186 0.16
187 0.17
188 0.16
189 0.13
190 0.1
191 0.08
192 0.1
193 0.11
194 0.11
195 0.09
196 0.13
197 0.14
198 0.13
199 0.15
200 0.15
201 0.18
202 0.17
203 0.17
204 0.16
205 0.16
206 0.17
207 0.16
208 0.14
209 0.11
210 0.11
211 0.12
212 0.13
213 0.13
214 0.13
215 0.13
216 0.13
217 0.12
218 0.11
219 0.12
220 0.1
221 0.08
222 0.08
223 0.09
224 0.09
225 0.09
226 0.09
227 0.08
228 0.08
229 0.1
230 0.15
231 0.15
232 0.15
233 0.15
234 0.17
235 0.15
236 0.15
237 0.12
238 0.1
239 0.12
240 0.12
241 0.14
242 0.14
243 0.14
244 0.13
245 0.14
246 0.12
247 0.09
248 0.11
249 0.09
250 0.09
251 0.1
252 0.1
253 0.09
254 0.09
255 0.11
256 0.08
257 0.08
258 0.13
259 0.13
260 0.16
261 0.2
262 0.2
263 0.21
264 0.27
265 0.29
266 0.26
267 0.26
268 0.22
269 0.19
270 0.19
271 0.18
272 0.11
273 0.08
274 0.06
275 0.05
276 0.06
277 0.05
278 0.05
279 0.05
280 0.05
281 0.06
282 0.06
283 0.06
284 0.05
285 0.05
286 0.05
287 0.05
288 0.07
289 0.06
290 0.06
291 0.06
292 0.07
293 0.07
294 0.08
295 0.07
296 0.05
297 0.06
298 0.07
299 0.07
300 0.07
301 0.07
302 0.06
303 0.08
304 0.08
305 0.07
306 0.07
307 0.07
308 0.08
309 0.08
310 0.1
311 0.08
312 0.08
313 0.08
314 0.07
315 0.08
316 0.07
317 0.07
318 0.07
319 0.09
320 0.1
321 0.11
322 0.11
323 0.11
324 0.11
325 0.12
326 0.12
327 0.09
328 0.1
329 0.1
330 0.11
331 0.12
332 0.12
333 0.1
334 0.11
335 0.11
336 0.1
337 0.12
338 0.11
339 0.11
340 0.13
341 0.13
342 0.12
343 0.12
344 0.12
345 0.11
346 0.11
347 0.1
348 0.09
349 0.11
350 0.12
351 0.12
352 0.12
353 0.12
354 0.14
355 0.14
356 0.16
357 0.15
358 0.13
359 0.13
360 0.15
361 0.15
362 0.13
363 0.14
364 0.15
365 0.15
366 0.16
367 0.18
368 0.15
369 0.16
370 0.18
371 0.21
372 0.18
373 0.18
374 0.19
375 0.19
376 0.19
377 0.2
378 0.18
379 0.14
380 0.14
381 0.14
382 0.11
383 0.1
384 0.1
385 0.08
386 0.1
387 0.09
388 0.08
389 0.08
390 0.08
391 0.11
392 0.12
393 0.11
394 0.1
395 0.1
396 0.1
397 0.1
398 0.11
399 0.07
400 0.08
401 0.1
402 0.16
403 0.2
404 0.21
405 0.26
406 0.29
407 0.34
408 0.33
409 0.34
410 0.34
411 0.36
412 0.4
413 0.44
414 0.48
415 0.45
416 0.47
417 0.47
418 0.42
419 0.41
420 0.37
421 0.3
422 0.26
423 0.25
424 0.26
425 0.24
426 0.22
427 0.18
428 0.17
429 0.14
430 0.13
431 0.13
432 0.11
433 0.13
434 0.19
435 0.24
436 0.28
437 0.37
438 0.43
439 0.53
440 0.63
441 0.7
442 0.74
443 0.79
444 0.84
445 0.85
446 0.86
447 0.86
448 0.78