Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3NGH7

Protein Details
Accession J3NGH7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-78GGGGKDDKPKRSKSKKKKEVKPPPGKSRSGYBasic
NLS Segment(s)
PositionSequence
51-75GKDDKPKRSKSKKKKEVKPPPGKSR
Subcellular Location(s) nucl 16, mito_nucl 12.499, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MSGRQGCVPLLAPEGGEYEYAGYSYEYSGEYTGEHAAGGNSGGQGTSGGGGKDDKPKRSKSKKKKEVKPPPGKSRSGYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.11
4 0.09
5 0.08
6 0.08
7 0.08
8 0.07
9 0.06
10 0.06
11 0.06
12 0.07
13 0.06
14 0.07
15 0.07
16 0.07
17 0.07
18 0.07
19 0.08
20 0.07
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.04
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.04
34 0.05
35 0.05
36 0.05
37 0.07
38 0.09
39 0.19
40 0.24
41 0.3
42 0.35
43 0.44
44 0.54
45 0.65
46 0.74
47 0.76
48 0.83
49 0.87
50 0.92
51 0.93
52 0.94
53 0.94
54 0.94
55 0.94
56 0.93
57 0.94
58 0.91
59 0.85