Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8UGU0

Protein Details
Accession J8UGU0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-78PATIQKAKRKKLKVRYYGYKELSHydrophilic
NLS Segment(s)
PositionSequence
62-67AKRKKL
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences KAFKAKIISEPHKRIPGNTSALTVKKPVIYFKCGQLNHIAIACKIRTDNPKTPLAPATIQKAKRKKLKVRYYGYKELSYIRLAYFKKSKISLPNLTPLFGRLSTGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.55
3 0.53
4 0.49
5 0.43
6 0.39
7 0.35
8 0.36
9 0.35
10 0.32
11 0.26
12 0.23
13 0.23
14 0.27
15 0.27
16 0.31
17 0.32
18 0.36
19 0.43
20 0.39
21 0.4
22 0.37
23 0.34
24 0.29
25 0.3
26 0.24
27 0.16
28 0.18
29 0.17
30 0.13
31 0.12
32 0.16
33 0.21
34 0.27
35 0.34
36 0.35
37 0.41
38 0.4
39 0.41
40 0.38
41 0.33
42 0.28
43 0.23
44 0.25
45 0.27
46 0.31
47 0.37
48 0.43
49 0.48
50 0.55
51 0.63
52 0.66
53 0.71
54 0.77
55 0.79
56 0.81
57 0.84
58 0.83
59 0.83
60 0.77
61 0.68
62 0.59
63 0.51
64 0.44
65 0.35
66 0.28
67 0.2
68 0.23
69 0.22
70 0.28
71 0.31
72 0.32
73 0.36
74 0.37
75 0.41
76 0.44
77 0.51
78 0.53
79 0.5
80 0.56
81 0.52
82 0.51
83 0.46
84 0.38
85 0.34
86 0.26