Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N3NHW3

Protein Details
Accession A0A2N3NHW3    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
93-118MLQAKMHKKRVERLKRREKRNKMLNSBasic
NLS Segment(s)
PositionSequence
22-35KNGKQWHAPKKAFR
45-114KRAKQRVEMVAVKAKEKEMKDEKEAERQRRIQAIRDKRAAKEERERYEMLQAKMHKKRVERLKRREKRNK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTTEAPAATIAVPTKPLGMRKNGKQWHAPKKAFRPTAGLTSYEKRAKQRVEMVAVKAKEKEMKDEKEAERQRRIQAIRDKRAAKEERERYEMLQAKMHKKRVERLKRREKRNKMLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.16
4 0.22
5 0.24
6 0.33
7 0.4
8 0.46
9 0.56
10 0.59
11 0.61
12 0.64
13 0.69
14 0.71
15 0.73
16 0.72
17 0.7
18 0.73
19 0.79
20 0.73
21 0.65
22 0.6
23 0.52
24 0.53
25 0.45
26 0.38
27 0.32
28 0.31
29 0.36
30 0.34
31 0.34
32 0.31
33 0.36
34 0.35
35 0.36
36 0.4
37 0.38
38 0.4
39 0.4
40 0.39
41 0.38
42 0.37
43 0.34
44 0.27
45 0.24
46 0.23
47 0.2
48 0.25
49 0.27
50 0.29
51 0.32
52 0.38
53 0.39
54 0.45
55 0.51
56 0.5
57 0.5
58 0.5
59 0.5
60 0.51
61 0.5
62 0.48
63 0.52
64 0.56
65 0.56
66 0.6
67 0.6
68 0.54
69 0.62
70 0.59
71 0.55
72 0.55
73 0.57
74 0.55
75 0.57
76 0.57
77 0.49
78 0.54
79 0.54
80 0.45
81 0.42
82 0.43
83 0.48
84 0.54
85 0.6
86 0.55
87 0.54
88 0.62
89 0.67
90 0.72
91 0.73
92 0.77
93 0.81
94 0.86
95 0.92
96 0.94
97 0.93
98 0.93