Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N3NC72

Protein Details
Accession A0A2N3NC72    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-42GLLWKIPWRLSKFQKRRQRMRLRAVDQVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRMTNPLSGGLLWKIPWRLSKFQKRRQRMRLRAVDQVVATLDAALAKKGVTLEALERWKAEMPTEPEMMPRDKYTMFDRKVKGYRKGIHSEFIPGFSSSLELPPLFSKDKKVWIRFLPDEAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.18
5 0.18
6 0.2
7 0.27
8 0.31
9 0.38
10 0.47
11 0.58
12 0.65
13 0.72
14 0.8
15 0.84
16 0.88
17 0.9
18 0.91
19 0.9
20 0.9
21 0.9
22 0.83
23 0.81
24 0.72
25 0.63
26 0.52
27 0.42
28 0.32
29 0.22
30 0.17
31 0.09
32 0.07
33 0.06
34 0.06
35 0.05
36 0.05
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.11
45 0.13
46 0.12
47 0.12
48 0.13
49 0.14
50 0.14
51 0.13
52 0.13
53 0.16
54 0.19
55 0.2
56 0.19
57 0.19
58 0.22
59 0.23
60 0.19
61 0.16
62 0.15
63 0.14
64 0.16
65 0.21
66 0.28
67 0.3
68 0.36
69 0.37
70 0.42
71 0.5
72 0.55
73 0.57
74 0.57
75 0.6
76 0.6
77 0.66
78 0.6
79 0.56
80 0.5
81 0.48
82 0.4
83 0.35
84 0.3
85 0.22
86 0.2
87 0.17
88 0.17
89 0.11
90 0.12
91 0.12
92 0.1
93 0.11
94 0.13
95 0.17
96 0.2
97 0.21
98 0.26
99 0.28
100 0.39
101 0.47
102 0.5
103 0.54
104 0.56
105 0.64
106 0.61