Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PDX3

Protein Details
Accession J3PDX3    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-44LLEILRRERHRPRADRNDEHLBasic
NLS Segment(s)
Subcellular Location(s) nucl 6mito 6cysk 6mito_nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MSQPPHNDLEEGEPVHWRWTSPWLLEILRRERHRPRADRNDEHLGAMFDAASTGDFNRLKVALVTLTQSREQIDASMLHEHGGWDRHVTPLHAAASGGHLDAATLLIALGADLEASVGQAGDRFTPPLLPIMRLEQRSER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.24
4 0.19
5 0.16
6 0.21
7 0.25
8 0.23
9 0.24
10 0.24
11 0.26
12 0.29
13 0.35
14 0.36
15 0.4
16 0.42
17 0.47
18 0.53
19 0.62
20 0.68
21 0.69
22 0.72
23 0.75
24 0.81
25 0.81
26 0.79
27 0.78
28 0.68
29 0.6
30 0.5
31 0.39
32 0.3
33 0.22
34 0.15
35 0.06
36 0.06
37 0.05
38 0.04
39 0.04
40 0.04
41 0.1
42 0.1
43 0.1
44 0.11
45 0.12
46 0.12
47 0.11
48 0.12
49 0.07
50 0.07
51 0.09
52 0.09
53 0.11
54 0.11
55 0.11
56 0.11
57 0.11
58 0.1
59 0.09
60 0.09
61 0.08
62 0.09
63 0.1
64 0.1
65 0.09
66 0.09
67 0.09
68 0.09
69 0.1
70 0.09
71 0.09
72 0.1
73 0.12
74 0.12
75 0.13
76 0.12
77 0.14
78 0.15
79 0.13
80 0.12
81 0.11
82 0.12
83 0.12
84 0.1
85 0.07
86 0.06
87 0.05
88 0.05
89 0.06
90 0.04
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.03
103 0.03
104 0.03
105 0.03
106 0.05
107 0.05
108 0.08
109 0.09
110 0.1
111 0.11
112 0.12
113 0.13
114 0.19
115 0.19
116 0.19
117 0.2
118 0.27
119 0.34
120 0.35