Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N1JFK9

Protein Details
Accession A0A2N1JFK9   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
171-195VSPCTSKLNLTKKRHYMKAKPTNLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR032710  NTF2-like_dom_sf  
IPR007727  Spo12  
Pfam View protein in Pfam  
PF05032  Spo12  
Amino Acid Sequences MHHLSNLKCNATGLAPEHSMVLPEREVTDNERPIMNMLDELYTQFDEQRTSIFAPDVMYTMPNGNVIVGRAQVVQKLRERAVMHPGRTVSQRLLQTPESLPVYAMVVDQVVSCENEAQLTSGRNLLVLKRRVQDGLVTSITEEEGHRKATVPLAARAGMANVFCSPTDKMVSPCTSKLNLTKKRHYMKAKPTNLFASMTSTQSSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.21
5 0.19
6 0.19
7 0.17
8 0.16
9 0.13
10 0.13
11 0.15
12 0.15
13 0.17
14 0.22
15 0.28
16 0.29
17 0.3
18 0.29
19 0.27
20 0.27
21 0.27
22 0.21
23 0.15
24 0.12
25 0.12
26 0.11
27 0.12
28 0.12
29 0.11
30 0.11
31 0.11
32 0.11
33 0.12
34 0.12
35 0.12
36 0.13
37 0.13
38 0.14
39 0.12
40 0.12
41 0.12
42 0.12
43 0.12
44 0.1
45 0.09
46 0.09
47 0.09
48 0.09
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.08
58 0.08
59 0.11
60 0.13
61 0.16
62 0.2
63 0.23
64 0.23
65 0.27
66 0.29
67 0.28
68 0.36
69 0.37
70 0.33
71 0.32
72 0.32
73 0.29
74 0.29
75 0.29
76 0.2
77 0.2
78 0.21
79 0.2
80 0.23
81 0.22
82 0.22
83 0.21
84 0.22
85 0.18
86 0.16
87 0.14
88 0.11
89 0.1
90 0.08
91 0.08
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.06
106 0.07
107 0.08
108 0.09
109 0.09
110 0.09
111 0.1
112 0.12
113 0.19
114 0.22
115 0.26
116 0.26
117 0.28
118 0.28
119 0.28
120 0.27
121 0.22
122 0.23
123 0.19
124 0.17
125 0.16
126 0.16
127 0.15
128 0.13
129 0.11
130 0.1
131 0.11
132 0.12
133 0.12
134 0.13
135 0.14
136 0.17
137 0.21
138 0.2
139 0.21
140 0.22
141 0.22
142 0.21
143 0.2
144 0.17
145 0.14
146 0.12
147 0.1
148 0.08
149 0.09
150 0.09
151 0.12
152 0.12
153 0.13
154 0.16
155 0.16
156 0.18
157 0.24
158 0.28
159 0.29
160 0.31
161 0.33
162 0.33
163 0.35
164 0.41
165 0.45
166 0.51
167 0.56
168 0.64
169 0.69
170 0.75
171 0.81
172 0.82
173 0.82
174 0.83
175 0.85
176 0.85
177 0.8
178 0.76
179 0.71
180 0.64
181 0.55
182 0.45
183 0.41
184 0.33
185 0.31