Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3PKT0

Protein Details
Accession J3PKT0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-27KISGARVRKRGEPRKGKNPMSRAPBasic
NLS Segment(s)
PositionSequence
8-22ARVRKRGEPRKGKNP
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MLQKISGARVRKRGEPRKGKNPMSRAPPSQVTLTMIAARTRPGFPALQLPASRSATQPYDLEERSIAVVDVVFVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.79
4 0.81
5 0.87
6 0.87
7 0.84
8 0.81
9 0.77
10 0.74
11 0.71
12 0.63
13 0.58
14 0.52
15 0.46
16 0.39
17 0.33
18 0.27
19 0.22
20 0.19
21 0.16
22 0.14
23 0.12
24 0.11
25 0.12
26 0.11
27 0.1
28 0.11
29 0.11
30 0.11
31 0.11
32 0.18
33 0.18
34 0.2
35 0.2
36 0.21
37 0.25
38 0.27
39 0.28
40 0.22
41 0.24
42 0.22
43 0.24
44 0.23
45 0.21
46 0.24
47 0.24
48 0.25
49 0.21
50 0.2
51 0.19
52 0.19
53 0.15
54 0.09
55 0.08