Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PIM7

Protein Details
Accession J3PIM7    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPTRPSSRRLTRSQRREESPPPASHydrophilic
NLS Segment(s)
PositionSequence
151-174FSKAERKLRRQWPSISWKGKVKSK
Subcellular Location(s) mito 15, nucl 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MPTRPSSRRLTRSQRREESPPPASPSPTASDVSFDEETPALQSSHVTLGTSLPPTPVPAFNDPFDSDPGDAFEPSLEPSDEEIETDDDTNVIPASQPASQVSLPASQRAQKRGKGFVWSGAQIVRFLQVLAGMGRAGQLDPRISNWQRKAFSKAERKLRRQWPSISWKGKVKSKYMYLKKRYREWEGFGKRSGVSVDPDTGRYIASRNCFEAYFQVNSAARWILKGPPEHLDLCRAVFDGNWASGDLATTAGGRLRDQGLARPLPEAEQDPFESESNDSADGAGGAFAGPVATPAGPPQALTVARAQYYVGESLREAARTLAGQPCPATPGSSGTSPTSSAGTSRGAPSPYYLRSLEKWVEASKTLNKAPWKERLVARDRCKLISAFKADTGIAVWWLSLEEDRELIWEFVRGDSMSAMLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.84
4 0.82
5 0.8
6 0.76
7 0.72
8 0.68
9 0.62
10 0.58
11 0.52
12 0.48
13 0.43
14 0.39
15 0.35
16 0.27
17 0.27
18 0.25
19 0.3
20 0.26
21 0.21
22 0.2
23 0.19
24 0.18
25 0.17
26 0.18
27 0.12
28 0.11
29 0.11
30 0.11
31 0.14
32 0.14
33 0.13
34 0.12
35 0.14
36 0.17
37 0.19
38 0.17
39 0.15
40 0.15
41 0.18
42 0.2
43 0.21
44 0.23
45 0.28
46 0.31
47 0.31
48 0.35
49 0.33
50 0.32
51 0.31
52 0.28
53 0.21
54 0.18
55 0.2
56 0.17
57 0.16
58 0.14
59 0.12
60 0.11
61 0.11
62 0.13
63 0.11
64 0.1
65 0.12
66 0.14
67 0.14
68 0.13
69 0.14
70 0.13
71 0.13
72 0.13
73 0.12
74 0.09
75 0.09
76 0.09
77 0.08
78 0.06
79 0.06
80 0.05
81 0.08
82 0.09
83 0.1
84 0.1
85 0.14
86 0.14
87 0.15
88 0.16
89 0.19
90 0.19
91 0.21
92 0.22
93 0.24
94 0.29
95 0.37
96 0.42
97 0.41
98 0.45
99 0.5
100 0.5
101 0.51
102 0.48
103 0.45
104 0.43
105 0.38
106 0.35
107 0.29
108 0.27
109 0.21
110 0.2
111 0.15
112 0.11
113 0.1
114 0.08
115 0.07
116 0.07
117 0.07
118 0.07
119 0.05
120 0.05
121 0.06
122 0.06
123 0.06
124 0.06
125 0.07
126 0.09
127 0.09
128 0.12
129 0.2
130 0.23
131 0.31
132 0.36
133 0.42
134 0.44
135 0.46
136 0.5
137 0.48
138 0.54
139 0.57
140 0.58
141 0.62
142 0.68
143 0.72
144 0.75
145 0.79
146 0.77
147 0.73
148 0.7
149 0.68
150 0.68
151 0.71
152 0.66
153 0.6
154 0.59
155 0.58
156 0.59
157 0.54
158 0.49
159 0.45
160 0.48
161 0.54
162 0.57
163 0.63
164 0.66
165 0.71
166 0.72
167 0.74
168 0.72
169 0.7
170 0.64
171 0.59
172 0.6
173 0.6
174 0.57
175 0.5
176 0.46
177 0.38
178 0.34
179 0.3
180 0.2
181 0.15
182 0.13
183 0.15
184 0.13
185 0.14
186 0.14
187 0.13
188 0.12
189 0.1
190 0.11
191 0.12
192 0.14
193 0.15
194 0.15
195 0.16
196 0.16
197 0.16
198 0.17
199 0.17
200 0.15
201 0.14
202 0.16
203 0.15
204 0.15
205 0.16
206 0.13
207 0.1
208 0.1
209 0.11
210 0.11
211 0.14
212 0.15
213 0.16
214 0.18
215 0.21
216 0.22
217 0.21
218 0.21
219 0.18
220 0.17
221 0.16
222 0.13
223 0.11
224 0.09
225 0.11
226 0.08
227 0.08
228 0.08
229 0.08
230 0.08
231 0.07
232 0.08
233 0.06
234 0.05
235 0.05
236 0.04
237 0.04
238 0.06
239 0.06
240 0.07
241 0.08
242 0.09
243 0.12
244 0.12
245 0.16
246 0.2
247 0.21
248 0.21
249 0.2
250 0.19
251 0.17
252 0.18
253 0.17
254 0.12
255 0.13
256 0.14
257 0.15
258 0.16
259 0.16
260 0.15
261 0.14
262 0.14
263 0.12
264 0.12
265 0.1
266 0.08
267 0.08
268 0.07
269 0.06
270 0.05
271 0.04
272 0.03
273 0.03
274 0.03
275 0.03
276 0.02
277 0.03
278 0.04
279 0.04
280 0.04
281 0.05
282 0.08
283 0.08
284 0.08
285 0.08
286 0.12
287 0.12
288 0.14
289 0.17
290 0.16
291 0.17
292 0.17
293 0.16
294 0.13
295 0.15
296 0.16
297 0.12
298 0.11
299 0.11
300 0.14
301 0.15
302 0.14
303 0.13
304 0.11
305 0.12
306 0.12
307 0.14
308 0.17
309 0.17
310 0.18
311 0.18
312 0.18
313 0.19
314 0.19
315 0.18
316 0.13
317 0.16
318 0.17
319 0.18
320 0.2
321 0.19
322 0.2
323 0.2
324 0.2
325 0.17
326 0.14
327 0.14
328 0.14
329 0.14
330 0.15
331 0.16
332 0.19
333 0.19
334 0.19
335 0.22
336 0.26
337 0.26
338 0.28
339 0.27
340 0.27
341 0.28
342 0.35
343 0.34
344 0.31
345 0.32
346 0.3
347 0.32
348 0.3
349 0.32
350 0.32
351 0.35
352 0.35
353 0.37
354 0.41
355 0.46
356 0.5
357 0.55
358 0.53
359 0.54
360 0.57
361 0.61
362 0.64
363 0.66
364 0.68
365 0.68
366 0.66
367 0.61
368 0.59
369 0.52
370 0.49
371 0.48
372 0.47
373 0.4
374 0.38
375 0.38
376 0.35
377 0.32
378 0.28
379 0.2
380 0.14
381 0.11
382 0.1
383 0.08
384 0.08
385 0.09
386 0.09
387 0.1
388 0.1
389 0.11
390 0.11
391 0.13
392 0.15
393 0.14
394 0.13
395 0.15
396 0.15
397 0.15
398 0.18
399 0.16
400 0.15
401 0.14