Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N1J959

Protein Details
Accession A0A2N1J959   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VNIPKTRRTYCKGRACRRHTPHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGRACRRHTPHKVTQYKAGKASDYSQGKRRYVRKQKGYGGQTKPVFQKKAKTTKKVVLRLECTVCKYRMQLALKRCKQKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.84
4 0.89
5 0.87
6 0.88
7 0.87
8 0.85
9 0.84
10 0.84
11 0.84
12 0.76
13 0.77
14 0.74
15 0.68
16 0.64
17 0.55
18 0.46
19 0.39
20 0.39
21 0.38
22 0.35
23 0.34
24 0.36
25 0.41
26 0.43
27 0.48
28 0.53
29 0.55
30 0.6
31 0.67
32 0.69
33 0.7
34 0.74
35 0.76
36 0.74
37 0.72
38 0.64
39 0.61
40 0.53
41 0.5
42 0.49
43 0.47
44 0.45
45 0.38
46 0.43
47 0.45
48 0.55
49 0.59
50 0.6
51 0.6
52 0.64
53 0.71
54 0.71
55 0.69
56 0.66
57 0.62
58 0.61
59 0.6
60 0.55
61 0.51
62 0.47
63 0.41
64 0.36
65 0.34
66 0.34
67 0.37
68 0.4
69 0.42
70 0.47
71 0.57
72 0.63
73 0.71
74 0.71
75 0.73
76 0.72
77 0.76
78 0.76
79 0.75