Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PBG2

Protein Details
Accession J3PBG2    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-89DGNPDARRPRTRSRSPIKSRRVAPLSHydrophilic
NLS Segment(s)
PositionSequence
70-87RRPRTRSRSPIKSRRVAP
Subcellular Location(s) mito 10plas 10, cyto 3, nucl 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037997  Dgk1-like  
Gene Ontology GO:0016020  C:membrane  
GO:0004143  F:diacylglycerol kinase activity  
GO:0016779  F:nucleotidyltransferase activity  
Amino Acid Sequences MSAAVQRPPTTRVISPSPTPSERLRDAQASSQDSYLGPTTRSAARKRLSTPQPVEEDMDEDEYDGNPDARRPRTRSRSPIKSRRVAPLSSANGAKAAKISKTKATTLAPTPEYATDEKKSKGSATGATPVLPAIKTNGHLAPPTTAPPSSTSYWSWRDFSRSPSPLGLIPIHRHWRTFVHKHEVPRKFLHVSIGFVVVWLYLRGTQADAVWPWLLAALVPVSAVDLLRHHHPGFNRFYVSVLGALMRESEFSGYNGVIFYLLGALIVLYCFPKDVGTVGTLLLSWCDTAASTFGRLYGAYTPRIRRGKSLAGSSAAFLVGVATAASFWGWLVPTYGPLPGDEAFMFRGSLSLPPAVAEPLGLSAAQATVSGPVALGVVSLWSGFVAAASEVVDVFGWDDNLTIPVLSGFFIWGFLKAFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.49
4 0.52
5 0.49
6 0.5
7 0.49
8 0.49
9 0.49
10 0.49
11 0.46
12 0.44
13 0.44
14 0.47
15 0.49
16 0.46
17 0.42
18 0.38
19 0.34
20 0.29
21 0.3
22 0.26
23 0.21
24 0.17
25 0.17
26 0.2
27 0.26
28 0.32
29 0.34
30 0.4
31 0.43
32 0.49
33 0.52
34 0.59
35 0.61
36 0.64
37 0.65
38 0.63
39 0.63
40 0.59
41 0.57
42 0.47
43 0.41
44 0.32
45 0.28
46 0.21
47 0.17
48 0.15
49 0.12
50 0.13
51 0.12
52 0.12
53 0.1
54 0.14
55 0.21
56 0.28
57 0.36
58 0.42
59 0.52
60 0.61
61 0.7
62 0.76
63 0.79
64 0.83
65 0.86
66 0.9
67 0.88
68 0.87
69 0.82
70 0.81
71 0.76
72 0.65
73 0.59
74 0.58
75 0.52
76 0.47
77 0.43
78 0.33
79 0.32
80 0.31
81 0.26
82 0.2
83 0.18
84 0.19
85 0.24
86 0.27
87 0.3
88 0.34
89 0.36
90 0.38
91 0.38
92 0.38
93 0.38
94 0.41
95 0.35
96 0.32
97 0.32
98 0.28
99 0.28
100 0.25
101 0.25
102 0.22
103 0.25
104 0.26
105 0.26
106 0.26
107 0.24
108 0.26
109 0.25
110 0.24
111 0.24
112 0.27
113 0.26
114 0.25
115 0.24
116 0.2
117 0.19
118 0.15
119 0.12
120 0.09
121 0.1
122 0.11
123 0.14
124 0.16
125 0.15
126 0.16
127 0.17
128 0.16
129 0.16
130 0.17
131 0.16
132 0.14
133 0.14
134 0.16
135 0.2
136 0.2
137 0.21
138 0.21
139 0.25
140 0.3
141 0.32
142 0.31
143 0.27
144 0.32
145 0.31
146 0.36
147 0.39
148 0.36
149 0.36
150 0.34
151 0.34
152 0.29
153 0.3
154 0.26
155 0.19
156 0.2
157 0.24
158 0.3
159 0.29
160 0.29
161 0.28
162 0.32
163 0.38
164 0.42
165 0.42
166 0.44
167 0.47
168 0.54
169 0.62
170 0.6
171 0.57
172 0.52
173 0.5
174 0.43
175 0.4
176 0.39
177 0.3
178 0.26
179 0.22
180 0.21
181 0.17
182 0.15
183 0.14
184 0.08
185 0.07
186 0.06
187 0.05
188 0.04
189 0.05
190 0.05
191 0.06
192 0.06
193 0.06
194 0.07
195 0.07
196 0.07
197 0.07
198 0.07
199 0.06
200 0.06
201 0.05
202 0.04
203 0.04
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.04
213 0.06
214 0.08
215 0.11
216 0.11
217 0.14
218 0.16
219 0.22
220 0.26
221 0.27
222 0.26
223 0.23
224 0.23
225 0.22
226 0.2
227 0.15
228 0.1
229 0.08
230 0.07
231 0.06
232 0.06
233 0.05
234 0.05
235 0.05
236 0.06
237 0.06
238 0.07
239 0.08
240 0.07
241 0.07
242 0.07
243 0.07
244 0.06
245 0.05
246 0.04
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.02
253 0.03
254 0.03
255 0.03
256 0.03
257 0.04
258 0.04
259 0.04
260 0.05
261 0.06
262 0.07
263 0.07
264 0.08
265 0.08
266 0.08
267 0.07
268 0.07
269 0.06
270 0.05
271 0.05
272 0.04
273 0.04
274 0.04
275 0.04
276 0.06
277 0.07
278 0.08
279 0.08
280 0.08
281 0.09
282 0.09
283 0.1
284 0.14
285 0.16
286 0.2
287 0.25
288 0.28
289 0.37
290 0.43
291 0.42
292 0.41
293 0.44
294 0.48
295 0.48
296 0.49
297 0.43
298 0.4
299 0.39
300 0.35
301 0.29
302 0.2
303 0.15
304 0.1
305 0.08
306 0.05
307 0.04
308 0.04
309 0.03
310 0.03
311 0.03
312 0.03
313 0.03
314 0.03
315 0.04
316 0.04
317 0.05
318 0.07
319 0.07
320 0.09
321 0.1
322 0.12
323 0.11
324 0.11
325 0.14
326 0.12
327 0.14
328 0.12
329 0.13
330 0.13
331 0.13
332 0.13
333 0.1
334 0.1
335 0.09
336 0.11
337 0.12
338 0.11
339 0.11
340 0.11
341 0.12
342 0.12
343 0.11
344 0.09
345 0.07
346 0.07
347 0.08
348 0.07
349 0.06
350 0.06
351 0.06
352 0.06
353 0.06
354 0.05
355 0.06
356 0.07
357 0.07
358 0.06
359 0.06
360 0.06
361 0.06
362 0.06
363 0.04
364 0.04
365 0.04
366 0.04
367 0.04
368 0.04
369 0.04
370 0.04
371 0.04
372 0.05
373 0.05
374 0.05
375 0.06
376 0.06
377 0.06
378 0.06
379 0.06
380 0.05
381 0.06
382 0.07
383 0.07
384 0.07
385 0.07
386 0.08
387 0.09
388 0.09
389 0.08
390 0.07
391 0.07
392 0.08
393 0.08
394 0.07
395 0.07
396 0.07
397 0.09
398 0.1
399 0.11