Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N1JC03

Protein Details
Accession A0A2N1JC03   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
19-42WKNPWRLSSTRKTRVRQRLRDVDGHydrophilic
80-107PRGVNFRKSVHKVPKWTRKTLRVNPRGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MSFAGAFRPSGAALSGLLWKNPWRLSSTRKTRVRQRLRDVDGVIEAVRASGVECKALARDLQLPSESAMEPRDKYTVFSPRGVNFRKSVHKVPKWTRKTLRVNPRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.15
3 0.15
4 0.15
5 0.15
6 0.17
7 0.22
8 0.23
9 0.23
10 0.22
11 0.26
12 0.34
13 0.43
14 0.51
15 0.57
16 0.63
17 0.68
18 0.74
19 0.81
20 0.84
21 0.82
22 0.82
23 0.81
24 0.78
25 0.76
26 0.66
27 0.56
28 0.45
29 0.36
30 0.27
31 0.17
32 0.11
33 0.06
34 0.05
35 0.04
36 0.04
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.07
43 0.08
44 0.08
45 0.07
46 0.11
47 0.12
48 0.13
49 0.14
50 0.14
51 0.14
52 0.16
53 0.14
54 0.1
55 0.12
56 0.13
57 0.13
58 0.14
59 0.16
60 0.14
61 0.16
62 0.21
63 0.28
64 0.28
65 0.31
66 0.34
67 0.35
68 0.44
69 0.46
70 0.44
71 0.39
72 0.42
73 0.48
74 0.5
75 0.56
76 0.58
77 0.61
78 0.68
79 0.76
80 0.8
81 0.78
82 0.82
83 0.82
84 0.81
85 0.85
86 0.85
87 0.85