Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P148

Protein Details
Accession J3P148    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
106-133DCNYWCADPRERRRRRRRGDDNDNDNDSHydrophilic
NLS Segment(s)
PositionSequence
115-123RERRRRRRR
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 4, plas 2
Family & Domain DBs
Amino Acid Sequences MRHRAHLAPRGENRNSTPSSTLRDLEPQGQAPTQQKNTPTGRTSPPKPKPSSMSLDAEPGPCTYLVYWARDSPGGWTSAHSTSGPVESRRVNECCRPERLTRAGDDCNYWCADPRERRRRRRRGDDNDNDNDSGCSPAQRLRGCLRGNATAEPYKSRCVAPQPPPTTTPGPSDGGVDGTAGPSKNAAGGTRTPKMGMRILLMQALVISSLLARPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.54
3 0.48
4 0.44
5 0.39
6 0.42
7 0.41
8 0.38
9 0.33
10 0.36
11 0.36
12 0.36
13 0.36
14 0.32
15 0.3
16 0.3
17 0.32
18 0.31
19 0.36
20 0.36
21 0.36
22 0.36
23 0.41
24 0.45
25 0.47
26 0.45
27 0.43
28 0.47
29 0.52
30 0.57
31 0.6
32 0.65
33 0.69
34 0.7
35 0.71
36 0.68
37 0.66
38 0.65
39 0.59
40 0.54
41 0.45
42 0.44
43 0.39
44 0.35
45 0.29
46 0.22
47 0.18
48 0.13
49 0.13
50 0.09
51 0.15
52 0.16
53 0.19
54 0.2
55 0.2
56 0.21
57 0.21
58 0.21
59 0.17
60 0.16
61 0.14
62 0.13
63 0.13
64 0.15
65 0.16
66 0.17
67 0.14
68 0.13
69 0.12
70 0.15
71 0.16
72 0.14
73 0.16
74 0.16
75 0.19
76 0.23
77 0.25
78 0.25
79 0.29
80 0.35
81 0.36
82 0.4
83 0.41
84 0.39
85 0.42
86 0.43
87 0.39
88 0.34
89 0.34
90 0.31
91 0.28
92 0.27
93 0.22
94 0.19
95 0.17
96 0.15
97 0.13
98 0.14
99 0.2
100 0.27
101 0.38
102 0.47
103 0.56
104 0.68
105 0.76
106 0.85
107 0.88
108 0.9
109 0.91
110 0.9
111 0.92
112 0.91
113 0.88
114 0.83
115 0.75
116 0.64
117 0.53
118 0.42
119 0.31
120 0.23
121 0.15
122 0.1
123 0.09
124 0.13
125 0.18
126 0.19
127 0.23
128 0.24
129 0.32
130 0.32
131 0.34
132 0.34
133 0.33
134 0.34
135 0.31
136 0.32
137 0.28
138 0.28
139 0.3
140 0.28
141 0.26
142 0.25
143 0.25
144 0.24
145 0.28
146 0.36
147 0.4
148 0.49
149 0.51
150 0.52
151 0.53
152 0.55
153 0.51
154 0.44
155 0.39
156 0.32
157 0.3
158 0.27
159 0.27
160 0.22
161 0.2
162 0.18
163 0.14
164 0.1
165 0.09
166 0.11
167 0.1
168 0.09
169 0.09
170 0.09
171 0.1
172 0.11
173 0.11
174 0.13
175 0.19
176 0.26
177 0.29
178 0.3
179 0.3
180 0.31
181 0.34
182 0.35
183 0.3
184 0.27
185 0.28
186 0.28
187 0.28
188 0.25
189 0.21
190 0.16
191 0.15
192 0.11
193 0.07
194 0.06
195 0.04