Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NLM4

Protein Details
Accession J3NLM4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
100-128ASRRILPRPKRSNRSRNTQTQKRPRSRTLHydrophilic
NLS Segment(s)
PositionSequence
104-115ILPRPKRSNRSR
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
PROSITE View protein in PROSITE  
PS00948  RIBOSOMAL_S7E  
Amino Acid Sequences MTTPALNKIAANSPSRQNPSELETSIAGALYDLETNTADLKSALRPLQLVSAREIEVGNGKKAIAIFVPVPSLQGFHRVQQRLTRELEKKFSDRHVLILASRRILPRPKRSNRSRNTQTQKRPRSRTLTAVHDAILTDLVYPVEIVGKRLRTKEDNSKVLKVILDEKERGGVDYRLDTYSEVYRRLTGRVVVFEFPQAGATDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.46
4 0.41
5 0.4
6 0.42
7 0.42
8 0.36
9 0.31
10 0.26
11 0.25
12 0.23
13 0.2
14 0.14
15 0.09
16 0.09
17 0.07
18 0.07
19 0.06
20 0.06
21 0.07
22 0.07
23 0.09
24 0.08
25 0.08
26 0.08
27 0.09
28 0.1
29 0.15
30 0.15
31 0.15
32 0.15
33 0.16
34 0.23
35 0.25
36 0.25
37 0.23
38 0.24
39 0.24
40 0.24
41 0.23
42 0.16
43 0.19
44 0.2
45 0.18
46 0.15
47 0.15
48 0.15
49 0.15
50 0.16
51 0.09
52 0.09
53 0.09
54 0.09
55 0.11
56 0.09
57 0.1
58 0.09
59 0.1
60 0.08
61 0.15
62 0.15
63 0.18
64 0.26
65 0.26
66 0.28
67 0.33
68 0.36
69 0.34
70 0.37
71 0.4
72 0.37
73 0.39
74 0.43
75 0.4
76 0.39
77 0.37
78 0.37
79 0.35
80 0.3
81 0.29
82 0.25
83 0.22
84 0.21
85 0.25
86 0.23
87 0.18
88 0.19
89 0.18
90 0.19
91 0.26
92 0.32
93 0.37
94 0.47
95 0.55
96 0.63
97 0.72
98 0.8
99 0.78
100 0.81
101 0.78
102 0.78
103 0.79
104 0.79
105 0.79
106 0.79
107 0.84
108 0.83
109 0.83
110 0.79
111 0.77
112 0.71
113 0.69
114 0.63
115 0.6
116 0.53
117 0.47
118 0.4
119 0.32
120 0.29
121 0.2
122 0.16
123 0.08
124 0.06
125 0.05
126 0.05
127 0.05
128 0.04
129 0.04
130 0.08
131 0.08
132 0.1
133 0.13
134 0.19
135 0.22
136 0.25
137 0.3
138 0.31
139 0.38
140 0.47
141 0.52
142 0.56
143 0.57
144 0.58
145 0.54
146 0.51
147 0.45
148 0.36
149 0.34
150 0.32
151 0.32
152 0.3
153 0.29
154 0.32
155 0.31
156 0.3
157 0.26
158 0.21
159 0.19
160 0.21
161 0.23
162 0.2
163 0.2
164 0.2
165 0.19
166 0.25
167 0.25
168 0.24
169 0.23
170 0.27
171 0.28
172 0.29
173 0.29
174 0.27
175 0.28
176 0.31
177 0.33
178 0.3
179 0.3
180 0.3
181 0.28
182 0.23
183 0.21