Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N1JF31

Protein Details
Accession A0A2N1JF31   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
146-176MSNDEREKERERKRVKKEKKIQREAEKDRVHBasic
NLS Segment(s)
PositionSequence
151-193REKERERKRVKKEKKIQREAEKDRVHDEKKSAWQKFAAKGAKK
Subcellular Location(s) mito 10, nucl 9, cyto 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002999  Tudor  
PROSITE View protein in PROSITE  
PS50304  TUDOR  
Amino Acid Sequences MMWRSVQLTQVDAALEAEPENEELKGLRAELANLVALTKSLNAEKEQESDAKARQITLEPNTVPKQTFRAGDDVMARHAADGKWYPGKVASVAGQADSPLYSIIYTKTRTTEMLTADSLRVRKMDPNAAPPASAKSSAKANAQRMMSNDEREKERERKRVKKEKKIQREAEKDRVHDEKKSAWQKFAAKGAKKGYFGGSKNMFKTPEDPHAKIGIVGAGRGMTPSAQRSKHVYEEES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.08
5 0.08
6 0.09
7 0.09
8 0.08
9 0.08
10 0.08
11 0.1
12 0.11
13 0.11
14 0.12
15 0.11
16 0.13
17 0.14
18 0.14
19 0.13
20 0.12
21 0.12
22 0.09
23 0.09
24 0.08
25 0.08
26 0.08
27 0.1
28 0.12
29 0.13
30 0.17
31 0.19
32 0.21
33 0.22
34 0.22
35 0.23
36 0.24
37 0.25
38 0.26
39 0.24
40 0.22
41 0.22
42 0.23
43 0.25
44 0.26
45 0.28
46 0.24
47 0.29
48 0.31
49 0.32
50 0.3
51 0.26
52 0.27
53 0.25
54 0.27
55 0.23
56 0.25
57 0.23
58 0.25
59 0.27
60 0.23
61 0.21
62 0.19
63 0.17
64 0.13
65 0.15
66 0.12
67 0.12
68 0.12
69 0.14
70 0.17
71 0.17
72 0.18
73 0.16
74 0.17
75 0.15
76 0.15
77 0.13
78 0.11
79 0.12
80 0.12
81 0.1
82 0.1
83 0.09
84 0.08
85 0.07
86 0.04
87 0.04
88 0.04
89 0.04
90 0.06
91 0.09
92 0.11
93 0.12
94 0.13
95 0.14
96 0.15
97 0.17
98 0.18
99 0.16
100 0.17
101 0.17
102 0.16
103 0.15
104 0.16
105 0.15
106 0.12
107 0.11
108 0.09
109 0.12
110 0.14
111 0.21
112 0.2
113 0.25
114 0.29
115 0.28
116 0.28
117 0.25
118 0.25
119 0.19
120 0.2
121 0.15
122 0.13
123 0.16
124 0.18
125 0.23
126 0.26
127 0.28
128 0.31
129 0.32
130 0.32
131 0.3
132 0.34
133 0.31
134 0.29
135 0.29
136 0.27
137 0.28
138 0.31
139 0.35
140 0.39
141 0.45
142 0.51
143 0.58
144 0.65
145 0.73
146 0.81
147 0.85
148 0.87
149 0.89
150 0.9
151 0.92
152 0.92
153 0.91
154 0.9
155 0.9
156 0.87
157 0.86
158 0.8
159 0.7
160 0.64
161 0.63
162 0.55
163 0.48
164 0.43
165 0.39
166 0.44
167 0.52
168 0.5
169 0.44
170 0.48
171 0.5
172 0.52
173 0.55
174 0.53
175 0.48
176 0.52
177 0.57
178 0.56
179 0.52
180 0.49
181 0.45
182 0.44
183 0.42
184 0.44
185 0.44
186 0.44
187 0.46
188 0.48
189 0.44
190 0.38
191 0.41
192 0.38
193 0.41
194 0.44
195 0.43
196 0.42
197 0.43
198 0.42
199 0.37
200 0.33
201 0.26
202 0.18
203 0.16
204 0.13
205 0.1
206 0.1
207 0.1
208 0.1
209 0.08
210 0.11
211 0.17
212 0.24
213 0.26
214 0.3
215 0.36
216 0.41
217 0.48