Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N1JDB3

Protein Details
Accession A0A2N1JDB3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-27AAKLCKKPSSAKRRSTSDPKRHIEHydrophilic
NLS Segment(s)
PositionSequence
10-25KPSSAKRRSTSDPKRH
34-55PRAPQAPSAARKSGMRAKARRA
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGRAAKLCKKPSSAKRRSTSDPKRHIEAPLQDAPRAPQAPSAARKSGMRAKARRAANGPLPAEAGIDYVRLWEGKRSMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.78
4 0.8
5 0.81
6 0.82
7 0.81
8 0.81
9 0.76
10 0.72
11 0.67
12 0.62
13 0.57
14 0.51
15 0.46
16 0.43
17 0.4
18 0.36
19 0.34
20 0.32
21 0.31
22 0.27
23 0.2
24 0.16
25 0.17
26 0.21
27 0.25
28 0.27
29 0.23
30 0.24
31 0.24
32 0.26
33 0.31
34 0.34
35 0.38
36 0.39
37 0.45
38 0.51
39 0.53
40 0.53
41 0.5
42 0.48
43 0.46
44 0.49
45 0.43
46 0.36
47 0.35
48 0.3
49 0.27
50 0.21
51 0.15
52 0.09
53 0.08
54 0.07
55 0.07
56 0.08
57 0.09
58 0.1
59 0.14